Detailed information on CNT30577318


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695540Oryza barthiiOryza sativa38.6746.7499.6251forward
CNT30102816Oryza barthiiOryza rufipogon45.6141.2899.66296forward
CNT30117418Oryza barthiiOryza nivara39.9137.1199.61259forward

Expression of CNT30577318

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MKSSSGVVGNPHTHLSRNTAVGSGSANPAPAGQ*

Sequence

>CNT30577318
CTTTTGAAGAGATTTTCTGAAACAATAATAAAAGCTGTAGAGAAATGGAGTAGAAAATAGCAGGACCATTGTATGAAAAAAAAAAGCCCAAGCCTTGATA
GGAGTTATACACATGAAAAACAACCCAAACTTGGTTGAGTTAGCCCCTCTCGAGAGTAAAACACGGCCACTAATCTCAAAAAGCTAAGATTAACGTCATC
ATTTTCACCATATACCCCACGCGCAATTTACTAATTAATCGGAAACTGATGAAATCATCATCGGGTGTAGTTGGAAACCCCCACACCCACCTGAGCAGGA
ACACGGCGGTCGGGTCCGGGTCGGCGAACCCGGCGCCGGCCGGCCAGTAGGACGCCATGTCGAACGCCGGCGGCGGCCACTCGAAGTGCAGGTCCGGGTC
GGCCAGACTCTTGGTGATGGACGGGTAGTCGGAGAAGTCGAGGCCGAGGGTGACGGCGGCGGAGTCCGGCTGCAGGAGGTCCGTGAACGAGTCCTCCTCC
ACGGCCGGGACGACGACCTCCGTGGTGATCTCGCTCGTGGTGTCAGGCGCCGGCGGTGTCGTCGTCGTTGTGGAAGTCGTCGTCTTCTTCTCCGACGTAG
CTTCGGTCGTCGTCTTGGCGGCGGAGTCAGCGGCGGCTTCGGTGAGGAC