Detailed information on CNT30577292


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695632Oryza barthiiOryza sativa41.4449.4198.7460forward
CNT30675792Oryza barthiiSetaria viridis19.1930.5694.84213forward
CNT30523309Oryza barthiiSetaria italica20.2719.2195.11225forward
CNT30513114Oryza barthiiJuglans regia9.134.9585.15101forward
CNT30728535Oryza barthiiCorchorus capsularis8.6527.8382.2996forward
CNT30487770Oryza barthiiOlea europaea11.6228.681.4129forward
CNT30300839Oryza barthiiTriticum aestivum19.6420.4394.04218forward
CNT30224179Oryza barthiiHordeum vulgare8.2921.892.3992forward
CNT30554735Oryza barthiiOryza glaberrima10075.2599.641110forward
CNT30138628Oryza barthiiLolium perenne15.5936.7393.64173forward
CNT30205828Oryza barthiiHelianthus annuus7.7522.3487.2186forward
CNT30684486Oryza barthiiTriticum urartu10.3653.7494.78115forward
CNT30347972Oryza barthiiEragrostis tef14.6820.0795.71163forward
CNT30596737Oryza barthiiOryza meridionalis36.7667.1196.32408forward
CNT30370926Oryza barthiiOryza glumipatula10090.3298.921110forward
CNT30150529Oryza barthiiBrachypodium distachyon11.0830.5285.37123forward
CNT30102863Oryza barthiiOryza rufipogon51.0856.3699.12567forward
CNT30584554Oryza barthiiEchinochloa crusgalli5.9530.793.9466forward
CNT30117373Oryza barthiiOryza nivara39.7328.1899.09441forward
CNT30604528Oryza barthiiOryza punctata50.1848.7786.54557forward

Expression of CNT30577292

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MEDCPRKVDLSDADGRRAATGARAVTDAMA*

>peptide 2 (62 aa)
MMVLCHGSDRCCSRLSKGPFCVTLCCTRNPKNASIASLPATTTSTKIQNNGVVSLYAALLFL*

>peptide 3 (84 aa)
MHAGNNYHNTHSKSESHHIHISLSPPPNSLTSYTCILHKKKKKKQEENIFDRPIIGFTSLNSSSSLRCPGPDEIDHTLSLTASG*

>peptide 4 (34 aa)
MLLRVLVRFVPLASSFSLASRVGSKLRGLKTLPG*

>peptide 5 (37 aa)
MHTPQKKKEETRREHLRSPNHRFHQPELIKLLEMPWP*

>peptide 6 (34 aa)
MHPDPCMQETITTTHTVSLNLITSISLSLLPPIH*

Sequence

>CNT30577292
ATGCGCAAATGAAGCACTTGACAAGCAATTAAGCGTAGTTTATCCACCATAATTAAGATCGAGACCATGAGATAGCTAGAACACTGCTGCTACCATGAGA
TAGTTTATCCCCCTGTAGTACTGTACATCAGAAATTCACCACTCAACTCACCCCCTCACCCATGCATCCAGATCCATGCATGCAGGAAACAATTACCACA
ACACACACAGTAAGTCTGAATCTCATCACATCCATATCTCTCTCTCTCCTCCCCCCAATTCATTAACATCTTATACATGCATACTCCACAAAAAAAAAAA
GAAGAAACAAGAAGAGAACATCTTCGATCGCCCAATCATCGGTTTCACCAGCCTGAACTCATCAAGCTCCTTGAGATGCCCTGGCCCTGATGAAATCGAT
CACACGCTCAGCCTGACAGCGTCTGGATGATGGTGTTGTGCCACGGGTCAGACAGGTGCTGCAGCAGGTTGTCGAAGGGCCCCTTCTGCGTCACGTTGTG
CTGCACCAGGAACCCCAAGAACGCCAGCATCGCCAGCCTCCCTGCAACAACAACATCAACAAAAATTCAGAACAATGGCGTCGTTTCATTGTATGCTGCT
CTTCTTTTCTTATGATATATTGACGTGCAATGCTTTTACGTGTTTTGGTTAGATTCGTACCGTTGGCGAGCTCCTTCTCCTTGGCCTCGAGGGTGGGCTC
GAAGTTGAGGGGGTTGAAGACGCTGCCGGGGTAGCCGCACTCGTGCGGCGGGAGGCTGTAGCTCTTGAAGATGGGGTCCTGGTTGACGCAGCCAGGGTTC
TTGATGTCCTGCCACCGCCGGATCTCCACGTAGTGGAACAGGATGAACTCGATGACGAACAGCGTCGACGACGACGCGAAGTAGGTGGGAGAAGGGAGGC
CAGGGAGCCACTCTCCCTTGGCCTCCGCCCGAACATTACGCCTCGTAGTCGGTGCGCGGGCGAGACGGATGGAGGATTGCCCTAGGAAGGTAGACTTGAG
CGACGCCGACGGGCGGAGGGCTGCGACCGGGGCGCGGGCGGTGACGGACGCCATGGCTTAGCTTCCCCGGCTTAGAGAGGGGAGGAAGCGAAGCGGGTGT
AGTCACAAGG