Detailed information on CNT30577257


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554540Oryza barthiiOryza glaberrima40.378199.59729forward
CNT30370848Oryza barthiiOryza glumipatula20.8270.0298.4376forward
CNT30117351Oryza barthiiOryza nivara91.3139.7995.941649forward

Expression of CNT30577257

Peptides detected in this lncRNA

>peptide 1 (62 aa)
ALSSYSKLPAIEHTALRLLVFLALFMPCFFFLLLLLLLPVACSCCHHILASSSSSVRYSHLP*

>peptide 2 (50 aa)
MKKTKGLCNESKFHVLHFSAGVPFHMSCDSSRELHSYTTLYTAEHLSMMR*

>peptide 3 (39 aa)
MTSSTSLTYKKTRTTSNTGRHRVCLVRVKIGSFIKIKTM*

>peptide 4 (31 aa)
MWWPWLRSLVSRGCSSVFFPSHYLSHAASLT*

>peptide 5 (95 aa)
MIYDEFDNFINPCVFHVTFVLCTLFTKPLLTVFIIFFGDSPLEYVIFVFLYLLYILLEKYPYMAMGEIYFNLIIVIWFIIVMLLVIQKESYKKSI*

>peptide 6 (75 aa)
SLSLLTRNFQPSSTRLFACLCSWLSSCLASSSSSSSSSSPSRAPVATTSLPPPPPRYGIHIFHSGGIHGCSGRAR*

>peptide 7 (78 aa)
RSLFLLETSSHRAHGSSLACVPGSLHALLLLPPPPPPPPRRVLLLPPHPCLLLLLGTVFTSSIAEASMAAAAGQGDAR*

Sequence

>CNT30577257
TCGCTCTCTCTTCTTACTCGAAACTTCCAGCCATCGAGCACACGGCTCTTCGCTTGCTTGTGTTCCTGGCTCTCTTCATGCCTTGCTTCTTCTTCCTCCT
CCTCCTCCTCCTCCTCCCCGTCGCGTGCTCCTGTTGCCACCACATCCTTGCCTCCTCCTCCTCCTCGGTACGGTATTCACATCTTCCATAGCGGAGGCAT
CCATGGCTGCAGCGGCAGGGCAAGGTGATGCAAGATAGCAAGAAGATGCTGACCTCGCCGGTGCCCACACGATAGCGGCAGCAGGAGGGCAGAACGTGAG
GATGTCGGGGAGGGAGACACTGGACTTGCCATCGGCGTGGATCAGATGTGGTGGCCCTGGCTAAGGTCGCTCGTTTCACGAGGCTGCTCATCCGTGTTCT
TCCCTAGCCATTACCTCTCCCATGCTGCATCATTAACTTGATTTCGGCGGATGGAGTAGATGAAGAAAACAAAGGGCTTATGCAATGAATCGAAGTTCCA
TGTCCTGCATTTCTCAGCTGGAGTCCCATTTCACATGAGCTGTGATAGTAGTAGAGAACTGCATTCATACACTACTTTGTACACTGCAGAACATTTGAGC
ATGATGAGGTAGTAGACTTTCCAAACAGTAACTGCAACATAGGGGGTCAATCATTAATGACTAGCAGCACTTCTTTGACGTACAAGAAAACCAGGACGAC
TAGCAACACGGGTAGACATAGGGTGTGTTTAGTTCGTGTTAAAATTGGAAGTTTTATTAAAATTAAAACGATGTGACAAAAAAGTTAGAAGTTTATGTGT
GTAGAAAAGTTTTGATGTGTTGAAAATGTTGAAAGTTTGAAGAAAAATTTTAGAACTAAGCAAGGGCATAGAAAATTAACATCTGTAGGGGTTATCACTG
TCATCTAGCATCTGATGTTCGAAGCAGAAAACCTCATCATATCATAGTACTCTCATTTTTAAATAGATGATACCGTTGATTGATTTTTGGTCTGATCATT
TGTCTTATTAAAAAATTATATAAATACTATTTATTTTGTTGCAACTTAATTTATTCAAGGTGTTTTTGCCTCAAATTTTTGTACGTTGTCCGATTTATTA
TCCATCGTCGCGTCGGCTTTGTTGCCGCACGTCGCTCGGAGACGGAGATGTACAGGCGCTGTTCTGCATCTGACCGAGGAAGCGCTCGTGAGTCCTGAAT
TTTTTTTTTTACCAGCTGGGCCATCTGCCCATCGCCCTAGTCCTCTTGGGCTCCTTCCTGCCTGGCCGGTCCTGCTCCTGCCCAGCTAAATAGTTAATGA
TTTTTTTCTGTTGTATTCTCTGCTTTTTGGTATAAATAAACGGGAGAAGATCCTGTACATGATTTATGATGAATTTGATAATTTTATCAACCCATGCGTT
TTTCATGTAACGTTTGTGTTGTGTACCCTTTTCACTAAGCCACTTTTAACTGTATTCATTATTTTCTTTGGTGATTCACCACTTGAATATGTAATATTTG
TATTTCTTTACCTATTATACATATTACTAGAAAAATACCCGTATATGGCAATGGGTGAAATCTATTTTAATCTTATTATTGTTATATGGTTTATTATTGT
TATGCTTCTAGTAATACAGAAAGAATCATATAAGAAATCTATTTAAAAAAGAACTCGCATGCTAACTACTCCTAACTGTAGCTCATAATTTTCTAAAAAT
ATATATATATCCAACCTAACTCTCACAGTGAATTCCATTTTAACTAAACCATATAACAATAATAAAATTAAAATAGCCTTCACCCGTTGCAACGCACGGG
TATTTT