Detailed information on CNT30577247


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695338Oryza barthiiOryza sativa31.8637.2597.69130forward
CNT30108096Oryza barthiiOryza longistaminata46.3217.04100189forward
CNT30117408Oryza barthiiOryza nivara43.1433.498.3176forward

Expression of CNT30577247

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MGWNGVSCCARRRWLRLAEQIIVEVTFYGARHTKWLIF*

>peptide 2 (36 aa)
MVWREFYKVTYIATISTYMAQVIFSQVHFNMLFVVFR

>peptide 3 (67 aa)
PTETNPPNLIRAGGDDGGGGSSSPPCPVLGVGLGTGWDGMEWRLLLRSPEMAPPRRADYCRSNILWS*

Sequence

>CNT30577247
GCCCAACGGAAACAAATCCCCCAAATTTGATACGCGCCGGCGGTGACGACGGCGGCGGCGGCTCTTCTTCTCCGCCCTGTCCCGTTCTCGGAGTTGGGCT
AGGGACGGGATGGGATGGGATGGAATGGCGTCTCCTGCTGCGCTCGCCGGAGATGGCTCCGCCTCGCCGAGCAGATTATTGTCGAAGTAACATTTTATGG
AGCTAGACACACAAAATGGCTAATTTTCTAGCAGCAAAGAGTTATCCAAGGTTGTTTTGGAGTGAAGGCAGATAACCACCTAGGTCACAAAAACAGATGG
TATGGAGAGAGTTCTACAAAGTGACATACATCGCAACAATTTCTACCTATATGGCACAGGTAATTTTTTCCCAAGTCCACTTTAACATGCTTTTTGTGGT
TTTTCGTT