Detailed information on CNT30577158


BLAST search results

BLAST vs Swiss-Prot:
sp|P0C1M0|ATPG_MAIZE, E-value = 4e-132

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694821Oryza barthiiOryza sativa43.7753.4699.35618forward
CNT30671983Oryza barthiiSetaria viridis18.9152.7796.25267forward
CNT30289322Oryza barthiiTriticum aestivum6.3725.079090forward
CNT30221396Oryza barthiiHordeum vulgare18.722.392.05264forward
CNT30554409Oryza barthiiOryza glaberrima64.1664.53100906forward
CNT30243524Oryza barthiiAvena sativa18.729.4393.18264forward
CNT30659962Oryza barthiiTriticum dicoccoides15.5856.4190220forward
CNT30720275Oryza barthiiTriticum spelta18.741.7793.18264forward
CNT30363035Oryza barthiiSorghum bicolor19.0538.1694.05269forward
CNT30102695Oryza barthiiOryza rufipogon38.745399.45547forward

Expression of CNT30577158

Peptides detected in this lncRNA

>peptide 1 (64 aa)
ELKSCVSRAINNYIDRVGSIFFPFFFRAITEITDTIAREKKEVKKNRVVYITAATSAAQARWMG*

>peptide 2 (86 aa)
MRLRSSRSEHRTTCRRPLLPLLGAERRRVARAEEDQAVERCEHDMAGGSPATAAAAAAAGGGKDFGLGLGGGEARRGEGPRLSRRK*

>peptide 3 (40 aa)
MERFFRSSMALSVALLMALILAASSLASDSWSARRIWLLR*

Sequence

>CNT30577158
TGAATTGAAATCTTGTGTATCTCGCGCGATTAACAATTACATCGATCGAGTCGGATCGATCTTTTTTCCTTTTTTTTTTCGTGCTATCACAGAAATTACA
GACACAATAGCAAGAGAGAAAAAGGAAGTCAAAAAGAATAGAGTAGTATATATAACAGCAGCAACCTCAGCAGCTCAAGCGAGGTGGATGGGATGAAGAA
ATGAGTTGATTGGATTTAGGCGAGGGCGTCGGCGCCGGCGACGATCTCGAGGATCTCGCCGGTGATCTTGGCCTGGCGCTGGCGGTTGTAGACCATGGAG
AGGTTCTTCCGGAGCTCGATGGCGTTGTCGGTGGCGCTGCTCATGGCGCTCATCCTGGCGGCGAGCTCGCTGGCGAGCGACTCCTGGAGCGCGCGGAGGA
TCTGGCTGTTGAGGTAGAGCGGGAGGAGCGCGTCGAGGATCTGGACGGGGTCCTGCTCGAACTGCACCACGGGTGAGAAGGGCTGCCTCGTCCTCGGTGG
CGTCCACGCACACGCCGTTGATGTCGCAGATCTCCCCCTTGGGCGACATGGGGAGCAGCGTCTGGATGATGGGGTCGGAGCGGACGAGGGAGACGAACTT
GGAGTAGAGGAGCTCCACCTTGTCCACCGCCTCGGACACGAACAGCGAGTAGACGAGGTCGCAGATGGACTGGGAGTCCTTCACGGTGGGGATGCCGTTC
ACCTCCAGCGTCCGCTCGGTGGGGATGAAGGGGCGGCGGATGAAGTAGGCGTTGCCCTTCTTGCCGACGCTGACGACGGTGTACTCGAGGACGTTGTTGT
TGAAGCTGCCGCAGAGGCCGCGCTCGCCGGTGAGGACGACGAGGGCGACCTTCTTGACGGGGCGGATGCGGGTGAGGGGGAGATCGATGTCCTCCGTCTG
GATCTCCTGGTTCATGTTGTAGAGCACCTCCACCAACGCCTCCGAGAAGGGGCGGGAGGACACCACCGCCTCCTGCGCCCGCCGCACCTTGGCCGCCGCC
ACCAGCTTCATCGCCTCCGTGATCTTCTGCGTGTTGCGCACCGAGTCGATGCGGCTCCGCAGCTCACGCAGCGAGCACCGCACCACCTGCAGGCGGCCGC
TGCTGCCGCTGCTAGGAGCGGAGCGGCGGCGGGTGGCCAGGGCGGAGGAGGACCAGGCGGTGGAGAGGTGCGAGCACGACATGGCTGGCGGGTCACCGGC
AACAGCGGCGGCGGCGGCGGCGGCGGGTGGAGGGAAAGATTTCGGATTGGGTTTGGGTGGAGGTGAGGCGAGGCGAGGCGAGGGGCCGAGGCTCTCCAGG
CGGAAGTAGGGCAGGTGGGGTTTTCAAGGCGGGGTGAGTGGTGGAGGAGGCAGTGGTCGGATCATGTGGATGGATGTGCTGCTGCTTCTGCTGCTTCCAT
TTCACTCGAATC