Detailed information on CNT30576990


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694998Oryza barthiiOryza sativa54.8256.54100324forward
CNT30673818Oryza barthiiSetaria viridis19.830.7192.31117forward
CNT30521745Oryza barthiiSetaria italica19.828.9692.31117forward
CNT30290454Oryza barthiiTriticum aestivum19.4653.2489.57115forward
CNT30387265Oryza barthiiTriticum turgidum19.4620.3989.57115forward
CNT30554372Oryza barthiiOryza glaberrima98.8210099.66584forward
CNT30244221Oryza barthiiAvena sativa19.4622.6891.3115forward
CNT30610134Oryza barthiiGossypium raimondii18.145.1585.05107forward
CNT30680603Oryza barthiiTriticum urartu23.6930.390.71140forward
CNT30117183Oryza barthiiOryza nivara69.7160.95100412forward

Expression of CNT30576990

Peptides detected in this lncRNA

>peptide 1 (69 aa)
MYSLPSLTVAEAGGGRHCRLVGWCLAADCLPESGAVCSVVEGEGDGARWRRDNEEESAVGARRWRGLVVF

Sequence

>CNT30576990
ATATATATGAGTGACATGTCAAGCATGGATTAAATTAACATAGATACAAAAATGAAACATGATTAATTACTAGGATTACTTAACACACGGATCACAGAAA
ATCAATCCTTGCATGCAGGGGAAATCGATGGATCGACCTCTCTCCTTAACTTGTTCTTAATTCTCATGTACAATCAAAGAAACACACACGCACACACACA
TGCGTGCACTGCATCTCTCTGAGCAACGAACTCGATTGATTTGATTTTGATTCGCTAGGGATTAAAGAGAAGCTGAGATAGAGATTTCGACGATCATGCG
ACGCTGAAGGAGCTGGCTGCGCTCTCGACGAACTTCCTGGCGCCCTTGAACCACCTCTTGTCGCCGGCCTGCGCCTTGCAGATGTACAGCTTGCCGTCGT
TGACGGTGGCCGAAGCAGGAGGTGGACGCCATTGCCGGCTGGTGGGCTGGTGCCTCGCCGCTGATTGCCTGCCTGAGAGTGGAGCGGTGTGTAGTGTGGT
GGAGGGAGAGGGTGATGGGGCGAGGTGGCGACGGGATAACGAAGAGGAGAGCGCGGTGGGGGCGCGGCGGTGGCGAGGACTTGTGGTGTTT