Detailed information on CNT30576982


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6Z4N6|40G2_ORYSJ, E-value = 8e-35

BLAST vs NONCODE:
NONZMAT000139, E-value = 9e-49

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520246Oryza barthiiSetaria italica32.6923.490.45220forward
CNT30180108Oryza barthiiSecale cereale32.5410091.78219forward
CNT30596646Oryza barthiiOryza meridionalis99.5590.9198.06670forward
CNT30370630Oryza barthiiOryza glumipatula49.03100.6197.58330forward
CNT30102506Oryza barthiiOryza rufipogon95.6910099.53644forward

Expression of CNT30576982

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MLFTMRTQRKPWPTSLLSVHSTDSSRYSGLY

>peptide 2 (35 aa)
MAMQCSSPSPESLQMQRSSNPSVRISDFFRGSEGN*

>peptide 3 (38 aa)
MEGVEVEVDVVHHADAAEAMADVLALRPQHRLVQVLRVV

>peptide 4 (49 aa)
MALCIVSGGTYTRGGSSSAGCHPRTTSTARSRCHRGCRRDPCRHGRRRS*

>peptide 5 (90 aa)
TNEPFIIHSLGIRKVESTGESKMSCIRFLNHMAPPPPLTSPTVSSHSNHWLAKRHTLTQTRGRTDTIDCHTPIDRTNEHGLISVADRSNY*

Sequence

>CNT30576982
AGACAAATGAGCCATTCATAATTCATTCATTAGGCATACGAAAAGTAGAGAGTACAGGGGAAAGCAAGATGAGTTGCATCAGATTTCTGAATCATATGGC
CCCTCCTCCTCCACTTACATCACCCACTGTTTCATCTCATAGCAATCACTGGCTCGCAAAAAGACACACACTGACACAAACTCGAGGACGGACGGACACC
ATTGACTGCCATACTCCGATCGATCGAACGAACGAACACGGTCTTATTTCGGTAGCAGATCGATCAAATTATTAGCTAGAGTAGAAGCAGAGCAGACGCG
ACGACGATGGCAATGCAATGCAGCTCCCCCTCCCCGGAATCTCTGCAGATGCAAAGAAGCAGCAATCCAAGTGTCAGAATCTCTGATTTCTTCAGAGGAT
CCGAAGGAAATTAATCGATCAGCGATGGCATTGTGCATTGTTAGCGGTGGAACTTACACCAGGGGAGGATCTTCCAGCGCTGGTTGTCACCCTCGCACCA
CTTCCACAGCACGATCTCGGTGCCATCGTGGATGCCGCCGTGATCCTTGTCGCCATGGAAGGCGTCGAAGTTGAGGTAGATGTTGTTCACCATGCGGACG
CAGCGGAAGCCATGGCCGACGTCCTTGCTCTCCGTCCACAGCACCGACTCGTCCAGGTACTCCGGGTTGTATG