Detailed information on CNT30576922


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 1e-162

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30576922

Peptides detected in this lncRNA

>peptide 1 (84 aa)
MVRLVFRPKSDERFARQYRFEPPPEFPLASPRSGIVRHLSGPDRRAPTRTLHRRSGLASGAAREGLPLVSFLAHPRFQNPLTCTH

>peptide 2 (53 aa)
MNAWLPQASYPFRHRNQASGSSRIASSAYQKWPTWSSRFRSAAHRSSRAVLPI*

>peptide 3 (59 aa)
MGSSYPEGNFGGNQLLDGSISLSPQVRRTICTSVSLRASTRVSSGFAALRHSSPSFGSR*

Sequence

>CNT30576922
GCGCCCCTAACGTGGGTCGGGGCGGGCGTTCAGTCATAATCCAGCACACGATAGCTTCGCACCACTAGCTTTTCAACCAAGCGTGATGACCAATTGTGCG
AATCAACGGTTCCTCTCGTACTAGGTTGAATTACTATCGCGGCACGGTCATTAGTAGGGTAAAACTAACCTGTCTCACGACGGTCTAAACCCAGCTCACG
TTCCCTATTGGTGGGTGAACAATCCAACACTTGGTGAATTCTGCTTCACAATGATAGGAAGAGCCGACATCGAATGATCAAAAAGCAACGTCGCTATGAA
CGCTTGGCTGCCACAAGCCAGTTATCCCTTTCGGCACCGTAACCAGGCTTCCGGTTCATCCCGCATCGCCAGTTCTGCTTACCAAAAATGGCCCACTTGG
AGCTCCCGATTCCGTAGCGCGGCTCACCGGAGCAGCCGCGCCGTCCTACCTATTTAAATTTTGAGAATAGGTCGAGGGCGTTGCGCCCCCGATGCCTCTA
ATCATTGGGTTTACCCGATAGAACTCGTAATGGGCTCCAGCTATCCTGAGGGAAACTTCGGAGGGAACCAGCTACTAGATGGTTCGATTAGTCTTTCGCC
CCAAGTCAGACGAACGATTTGCACGTCAGTATCGCTTCGAGCCTCCACCAGAGTTTCCTCTGGCTTCGCCGCGCTCAGGCATAGTTCGCCATCTTTCGGG
TCCCGATAGGCGTGCTCCAACTCGAACCCTTCACAGAAGATCAGGGTTGGCCAGCGGTGCGGCCCGCGAGGGCCTCCCGCTCGTCAGCTTCCTTGCACAT
CCCAGGTTTCAGAACCCGTTGACTTGCACGCATG