Detailed information on CNT30576914


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694571Oryza barthiiOryza sativa60.8271.1699.71686forward
CNT30553940Oryza barthiiOryza glaberrima46.2889.2399.81522forward
CNT30117033Oryza barthiiOryza nivara44.8655.1894.27506forward

Expression of CNT30576914

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MMRVLIFCPSQLIYSWGGFFFEQQGVMKSIAMRKC*

>peptide 2 (47 aa)
MLSASPLVDPVATTPTGHRRWQRDRVLYGMLLPHHPHRFGSLGHSKV*

>peptide 3 (48 aa)
MCQLLWLLFGVFLAGPTDGYKLETVSLNDASAYLLPKSADLQLGRFLL*

>peptide 4 (37 aa)
MLNVSLKVHVFVDFSKNEEERSLTPRKRWILASLEFF*

Sequence

>CNT30576914
GCCAAGTGGGGCACAGGAGACAGCTGTGTGAGTGGAGGATAAAATCCCCTTGTCGTTGTACTGATACGATTACGAAATGAGAAATGAAAAAGAATCTCTC
CTCCCCCAAGTTATGTCTCTTCTTCTCGCCTAAGTCTTCTTCTTCTTCTTCTTCTTCTTCCCCATGCTAGTTCATCGTGTCCCTCAACACCGGTGAGCTT
TGCCGCCACGGATTGGTGACACAGAGCCATCCCAGTAGATGCTCTCGGCCTCCCCACTAGTGGATCCGGTTGCCACCACTCCGACCGGCCATCGGCGCTG
GCAACGCGACCGCGTCCTCTACGGCATGCTCTTGCCCCATCATCCACATCGATTTGGGTCTTTGGGCCACTCCAAGGTCTAGCCTTCAAGGGCATGTCCG
CCTCCACCATGTCATCGTAGGGCACCGGTCCGCTGCCTTGGTCAGATACGATCGATCCAATCCGCACTGGTGCTCACTCTGCAGCGTGATCTTGAACCTG
TGGTGAATCCATGGAATGATCCCCTAATTCGAATCACACACAGAAAAGCAATGGCATCAGCTCATGTGCCAACTACTGTGGCTTCTATTTGGAGTTTTTC
TTGCAGGTCCAACAGATGGATATAAACTTGAGACTGTTTCTCTGAATGATGCGAGTGCTTATCTTCTGCCCAAGTCAGCTGATCTACAGTTGGGGAGGTT
TCTTCTTTGAGCAACAAGGTGTCATGAAGAGCATAGCTATGCGGAAATGTTGAATGTTTCTCTGAAAGTCCATGTTTTTGTGGACTTCTCTAAAAATGAG
GAAGAGCGCTCCTTGACTCCCCGAAAGAGATGGATCCTAGCATCCTTAGAGTTTTTCTAATCTATAGGCACGATTGTTTTTCATGTGTGGTTACTACTTT
TGTCTAAGTGCACGTTATTATACAAATTCATATTGGATATTGGTTGCGATGTAAATTATTTCCCCATGTAGTGTTAGATTACCATATCGATGTTTACATA
CCGGACATTTGTATTTATTATGTGCCATTGACTATATATTCCGCGCACGCAGCAGAGTGGCTGTTTCTTCTAGTACTTATTATATGACACCATATTACTC
TTTCCAAAAAAATATAGCGATTACTTCC