Detailed information on CNT30576889


BLAST search results

BLAST vs Swiss-Prot:
sp|P47815|IF1A_WHEAT, E-value = 8e-57

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671227Oryza barthiiSetaria viridis17.143.9296.43112forward
CNT30521379Oryza barthiiSetaria italica41.9843.7991.64275forward
CNT30616469Oryza barthiiSesamum indicum40.6135.9583.83266forward
CNT30630340Oryza barthiiVigna unguiculata27.9439.790.16183forward
CNT30708734Oryza barthiiGlycine max42.1448.7688.41276forward
CNT30304884Oryza barthiiTriticum aestivum25.3436.0197.59166forward
CNT3074265Oryza barthiiBrassica juncea40.9240.6785.07268forward
CNT30476314Oryza barthiiSaccharum spontaneum38.0236.1992.37249forward
CNT3011199Oryza barthiiZea mays32.0635.1890.48210forward
CNT30718760Oryza barthiiMalus domestica golden15.4227.4584.16101forward
CNT30368761Oryza barthiiSorghum bicolor42.1414.9692.39276forward
CNT30619918Oryza barthiiCajanus cajan42.1412.3890.58276forward
CNT30595805Oryza barthiiOryza meridionalis26.5640.6588.51174forward
CNT30573272Oryza barthiiVitis vinifera52.9847.8685.59347forward
CNT3055889Oryza barthiiAmborella trichopoda35.7332.5582.05234forward
CNT30102311Oryza barthiiOryza rufipogon100.3198.2196.5657forward
CNT30725237Oryza barthiiLupinus angustifolius23.8229.4387.18156forward

Expression of CNT30576889

Peptides detected in this lncRNA

>peptide 1 (47 aa)
SQLCIIIMYTRLKLRNPTIILPPQTMTQYLISHDETGNQTIHNSQPT*

>peptide 2 (32 aa)
PIMHNHHVYQIKVTESNNYFTTSNHDTISHIT*

>peptide 3 (88 aa)
MMSPAAIHTFLCILPRMWQRRLVPSTQMASQRPLPSIRVTWAYSCPSSLNTNSRLSSSASFLPLLRFFPPLPLFFGMAWLPAADPFFL*

Sequence

>CNT30576889
TCCCAATTATGCATAATCATCATGTATACCAGATTAAAGTTACGGAATCCAACAATTATTTTACCACCTCAAACCATGACACAATATCTCATATCACATG
ATGAAACCGGCAACCAAACAATCCATAACAGCCAGCCCACATAGTACCACACATAGCTATTAATTAGAACATAGCAAGTAAATTGTAGCTGCGGAGAAAG
AGAAAAGAGCTTAGATCTTGTCGATGTCCTCGTCCTCGAACTGGATGTAGTCGTCGTGGTCGCCGCCGTCCTCGGGCCCGATGACGTCGGCCTTGTCGTC
CTGGTAGTCGCGGAGGCCGACGAGGATGATGTCCCCGGCGGCGATCCACACCTTCTTGTGCATCTTGCCGCGGATGTGGCAGAGGCGCTTGGTGCCGTCG
ACGCAGATGGCCTCGCAGCGGCCGTTGCCGAGCATCCGCGTCACCTGGGCGTACTCCTGCCCGTCCTCCTTGAACACCAACTCGCGCTTGTCGTCGTCGG
CCTCGTTCTTACCCCTCTTGCGGTTCTTCCCTCCCTTACCCTTGTTCTTCGGCATGGCTTGGCTACCGGCGGCGGATCCCTTCTTCCTCTAGGCGTCGGC
GGAGATGCGAAACCCTCGCGTTTCGATCGAGATTGGGAGCGGTGGAGTTGCGGGA