Detailed information on CNT30576871


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SDM1|CB121_HORVU, E-value = 6e-77

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694403Oryza barthiiOryza sativa30.9353.3199.25266forward
CNT30673891Oryza barthiiSetaria viridis20.4736.8295.45176forward
CNT30521727Oryza barthiiSetaria italica18.1424.5388.46156forward
CNT30515355Oryza barthiiJuglans regia22.0930.8981.05190forward
CNT30304990Oryza barthiiTriticum aestivum19.366.1489.16166forward
CNT30400439Oryza barthiiTriticum turgidum14.1946.0492.62122forward
CNT30567058Oryza barthiiActinidia chinensis15.8137.7888.24136forward
CNT30588696Oryza barthiiMusa acuminata15.5849.8189.55134forward
CNT30443761Oryza barthiiAegilops tauschii25.1245.4784.72216forward
CNT30256504Oryza barthiiAvena sativa18.2636.5190.45157forward
CNT30669889Oryza barthiiTriticum dicoccoides19.365.3588.55166forward
CNT307903Oryza barthiiZea mays21.8648.9692.55188forward
CNT30344605Oryza barthiiEragrostis tef19.197594.55165forward
CNT3058384Oryza barthiiAmborella trichopoda18.2632.9184.08157forward
CNT30102128Oryza barthiiOryza rufipogon61.1690.8599.62526forward
CNT30580151Oryza barthiiEchinochloa crusgalli34.1955.7992.18294forward
CNT30497042Oryza barthiiDigitaria exilis23.3725.2893.53201forward
CNT30116039Oryza barthiiOryza nivara33.8449.9198.97291forward
CNT30551236Oryza barthiiOryza brachyantha28.3724.5295.08244forward

Expression of CNT30576871

Peptides detected in this lncRNA

>peptide 1 (78 aa)
MAAQWYTSDSLNRSKFSGTVGGAWLARHPLGGHGDAPGGGGVGADRQAAPVRRRRQQARHAHRAAAPQPARRHCRRRR*

>peptide 2 (82 aa)
MVRWCSAKAMATNSMTRIVGSVPHGTGLPRYVAWPPGSAAHSCACTQLPSPSASGTNTPGCTSVIQFSSVRPWRRSGTPPTP*

>peptide 3 (45 aa)
QFDFVFDTKIKMDGFTREHPLLKLYITRPTSSCLPADRCVRTRAQ*

>peptide 4 (40 aa)
MAPGCRGTWPGRRAPPPTPAPAPSCPAPAPPAPTPQAAQA*

>peptide 5 (61 aa)
TSLISCLIQKLRWTDSQESTLYLSFTLQGQPAAACRPTAACARARNNQPITHSTHAHKNPP*

>peptide 6 (51 aa)
MVLGMMMSPMLLCHGSERSRGGRRRRRGTSSSRGPSPWCAGARRRRWRRTR*

Sequence

>CNT30576871
ACCAGTTTGATTTCGTGTTTGATACAAAAATTAAGATGGACGGATTCACAAGAGAGCACCCTCTACTTAAGCTTTACATTACAAGGCCAACCAGCAGCTG
CCTGCCGGCCGACCGCTGCGTGCGCACGCGCGCGCAATAATCAACCAATCACACACAGTACGCACGCACATAAAAACCCCCCATAGCCTTCACGTACGCC
CGGACGCACGCACCGGTTCGTGCCAAGCTCAAGGGTAGATGGTTCTCGGGATGATGATGTCGCCGATGTTGTTGTGCCACGGGTCCGAGAGAAGCCGAGG
GGGTCGAAGGCGCCGCCGGGGTACTTCTTCTTCTCGGGGTCCTTCTCCATGGTGCGCTGGTGCTCGGCGAAGGCGATGGCGACGAACTCGATGACCAGGA
TCGTCGGCAGCGTGCCCCATGGCACCGGGTTGCCGAGGTACGTGGCCTGGCCGCCGGGCTCCGCCGCCCACTCCTGCGCCTGCACCCAGTTGCCCAGCCC
CAGCGCCTCCGGCACCAACACCCCAGGCTGCACAAGCGTGATTCAGTTCAGTTCAGTTCGTCCATGGCGGCGCAGTGGTACACCTCCGACTCCTTGAACC
GCTCGAAGTTCTCCGGCACGGTGGGCGGGGCGTGGCTGGCCCGGCATCCACTCGGCGGACATGGTGACGCGCCCGGAGGTGGTGGCGTAGGCGCAGACCG
GCAGGCGGCTCCTGTTCGACGACGGCGCCAGCAGGCTCGGCACGCCCACCGCGCTGCAGCTCCTCAGCCCGCTCGTCGCCATTGCCGCCGCCGCCGCTAG
CTTCTCCTCCTCCTCCTCCTCCTCGAACACACCAGCAAGAAGACGAAGTAGGAAGAAGAG