Detailed information on CNT30576850


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30554168Oryza barthiiOryza glaberrima89.2210099.88803forward
CNT30116878Oryza barthiiOryza nivara32.4465.4799.32292forward

Expression of CNT30576850

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MYNYEVHVNLGLFAVPVHHLDVSLPDACIEN*

>peptide 2 (58 aa)
TPDFSSSPPHYIAFRSPPLLRRLSPQPSPPPRSSTSSSRALRKGVHAATMPRPSGDVV*

>peptide 3 (41 aa)
RRPISLRRLRTTSPSARLLCFVAYPLSRHLRHGRRHLLPER*

>peptide 4 (68 aa)
DARFLFVASALHRLPLASSASSLIPSAVTSATVVDIFFPSVEERGSRCYNAETKRRCGLRPAELEVVS*

Sequence

>CNT30576850
AGACGCCCGATTTCTCTTCGTCGCCTCCGCACTACATCGCCTTCCGCTCGCCTCCTCTGCTTCGTCGCTTATCCCCTCAGCCGTCACCTCCGCCACGGTC
GTCGACATCTTCTTCCCGAGCGTTGAGGAAAGGGGTTCACGCTGCTACAATGCCGAGACCAAGCGGAGATGTGGTTTGAGGCCAGCAGAGCTGGAAGTGG
TATCATAGGAGCTATGACGATTTAGGGAAATCCACGGCGCGCAGTTGTAAGTTTATTTGGAGAAGTGGACATTACCAAAGACCAAGAGAAAGGTAACTTT
CTAATTTCTATATACAAAAAGAAGTGATCTTACCATCTGTGTTAGGTGCACAGGGAAAAGTGGTTTATGCCCTACTGATTTGATTTATCAGTATAGCGAG
TCAAGACGCAGAATTATATCATGTTAGATGTATAATTATGAAGTGCATGTGAATTTGGGTCTGTTTGCTGTCCCTGTGCACCACCTTGATGTCTCTTTGC
CGGACGCTTGCATTGAAAATTAAGGGAATCAATTGAATCCATTGTACTAATGCAAGTGATATGTAGAGACTTGTTTCTATGTTAGATAGTATGATTTCAT
TTATGTATTTAGGGGAAATGTTTTTAAGTTTGCTCTGAACTGCAAACATTTTTATGTACTAACACAGTTTGCTTGAGTGGGCTGACGCTATTTCGAATGA
TGTTCAGTTTCTCACAGATTCCATTGCTGTTTACATTTTGTATTTTTCTTCTATCAAACCAGATCAAGCTGTAGAAGAAACAAAGTAACACAGATTTTTT
TTTCAGCAACCTACAATGTCGATACAAAGTTGTCTTTGCAGAAACTTTTGTTGTTCTCGTTGGTAATGTACTCCGCATGAACAAAATATAAAGAATGGAC