Detailed information on CNT30576843


BLAST search results

BLAST vs Swiss-Prot:
sp|P69310|UBIQ_AVESA, E-value = 1e-39

BLAST vs NONCODE:
NONMEST001181, E-value = 2e-83

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30242628Oryza barthiiAvena sativa68.0859.3492.72467forward
CNT3067610Oryza barthiiLeersia perrieri74.6428.7894.73512forward
CNT30722781Oryza barthiiTriticum spelta67.9352.5492.27466forward

Expression of CNT30576843

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MPSLSWIFAFTLSIVSDDSTSRVMVLPVRVFTKICIPPLSLRTR*

>peptide 2 (32 aa)
RDHLFIIVLPCCSTTAKRFRHHQTRLTDTHYR*

>peptide 3 (44 aa)
MRRCWSGGMPSLSWILALTLSMVSEDSTSRVMVLPVRVFTKICIC

Sequence

>CNT30576843
TAGGGATCACTTATTCATTATAGTTCTTCCATGCTGCTCTACCACAGCAAAACGTTTCAGACACCATCAAACCAGACTTACGGATACGCATTACAGGTAA
ATAGTACACAATGAAACGGGACACGACTAAGGACCAGACCAGACAACCATAGCTCCATTGGGGAAGACAATAGGCAGACTTGTGAACCCTAGAACAGCAG
CAGCTCCATGGCTGAGGACTTACTGGCCACCACGGAGGCGGAGCACCAGGTGGAGTGTTGACTCCTTCTGGATGTTGTAATCCGCAAGGGTGCGGCCATC
CTCAAGCTGCTTACCAGCAAAGATCAGACGCTGCTGGTCCGGGGGGATGCCCTCCTTGTCCTGGATCTTCGCCTTCACGTTGTCAATAGTGTCGGACGAC
TCAACCTCAAGGGTAATGGTCTTGCCAGTCAGGGTCTTCACGAAGATCTGCATCCCACCCCTGAGCCTGAGAACCAGGTGAAGGGTGGACTCCTTCTGGA
TGTTGTAGTCAGCCAAGGGTGCGGCCATCCTCAAGCTGCTTGCCAGCGAAGATGAGACGCTGCTGGTCCGGGGGGATGCCCTCCTTGTCCTGGATCTTGG
CCTTGACATTGTCAATGGTGTCCGAGGACTCAACCTCGAGGGTGATGGTCTTGCCGGTGAGGGTCTTCACAAAGATCTGCATCTGC