Detailed information on CNT30576835


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30102347Oryza barthiiOryza rufipogon96.4101.6396.93750forward

Expression of CNT30576835

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MVALCEGWTRSQKAHLSRSAQSVEPTWQSSSAPSLPLPQHAASTLVYPDAAGSANASWPAAWASAME*

>peptide 2 (34 aa)
MNKYILHYDALILSELNLLAEYTLTNKIRVRSSP*

Sequence

>CNT30576835
TGAATATTGATTTCACTCCATTCTCAAATCGTGAAATCCCCAAATTATCACAGATCACATAATAGGATATCTCCAAATCCTCAAATCGATTATCTCCAAA
TACATCACAAATTCTAAAAAAAATTACATCACAAGTTCTTTAGAAAAAAAATCAAAATTTGTGTGTACGTTCATTCCTGGTACACACTGCTTCGCCCCAA
AAGAAAAATCAACGCATATGCATACATGAACAAATATATATTACATTACGATGCTCTCATATTGAGTGAATTGAATTTGCTAGCTGAATATACACTAACA
AATAAAATAAGAGTACGTAGTAGTCCGTAATTAAGCAGTGGTGCGGGCGAGCTGTTTGAAGTTGATGGGCTTGGTTAATTGGGCCGGGCCGTCGTAGTAG
GCCGCGGCGCTGAGCATGGTGGCCCTCTGCGAGGGGTGGACGCGGTCCCAGAAGGCCCACTTGTCGCGGTCGGCGCAGAGCGTGGAGCCCACCTGGCAGT
CCTCCTCCGCGCCCAGCCTCCCGCTCCCGCAGCACGCGGCGTCAACGCTGGTGTACCCGGACGCCGCGGGGTCGGCGAACGCGAGCTGGCCGGCGGCGTG
GGCGTCGGCGATGGAGTAGGCGAAGCCGGGAAGGCGCGCGGCGAGGTCGGAGAGGAGGGAGGCGAGGGCGTCGTCGCTGCAGGCGCCGGTGGGGCTCTGC
GCTCGCACCAGCGGCACGCAACCGACCAGCCCCACGTTGATGATGCCAAACTTCCTCGCCCCCATCTCGTACAGCTCC