Detailed information on CNT30576812


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694482Oryza barthiiOryza sativa39.7832.7898.32179forward
CNT30674280Oryza barthiiSetaria viridis13.7825.7388.7162forward
CNT30102047Oryza barthiiOryza rufipogon73.7866.9499.1332forward
CNT30604205Oryza barthiiOryza punctata56.2220.5785.77253forward
CNT3050155Oryza barthiiCucumis sativus14.2223.4485.9464forward
CNT3040375Oryza barthiiMarchantia polymorpha1625.0990.2872forward

Expression of CNT30576812

Peptides detected in this lncRNA

>peptide 1 (31 aa)
HIKVHTDEIAASLQLRYVFSADVQRAQWNHV*

>peptide 2 (32 aa)
MNRLMNSSPSTNRNLPDLLAESKSFNHLSCNT*

>peptide 3 (64 aa)
MNYTSICKNISPKLMCFLQIRLLHFTQGDEHTTQLSDKQLCLTVDEQAHELFPVHQSQLARSSC*

Sequence

>CNT30576812
AACATATTAAAGTCCACACGGATGAAATAGCTGCAAGCCTGCAACTGCGATATGTCTTCAGTGCAGATGTACAGCGAGCACAGTGGAATCATGTTTAGTT
AGCGATGCTATAATCGTAAGCACCAACTGTTTACTTGATCAATGTCAATATTTGCCATTCTTTACAATGAACTATACAAGTATATGCAAAAACATCTCGC
CTAAATTGATGTGCTTCCTACAAATTCGCCTTCTCCATTTCACCCAAGGGGATGAACATACAACGCAATTAAGCGACAAACAACTCTGCCTGACCGTCGA
TGAACAGGCTCATGAACTCTTCCCCGTCCACCAATCGCAACTTGCCCGATCTTCTTGCTGAATCCAAATCTTTCAACCATTTGTCTTGCAACACGTGAAA
CCTGCATAAAATCGTTGGAGGCCCCAGTTGTCACATTTTCTTGGCCAAAG