Detailed information on CNT30576811


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30521762Oryza barthiiSetaria italica28.3434.3592.36157forward

Expression of CNT30576811

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MKGTLQPSFRWPVSWSVRRSMWYMKAAMSAAPMPPMAVQYRVS*

>peptide 2 (86 aa)
MQTPPIAYNVPLVKMHIVAKDERNTATKLPMACELVSAPKHVVHESSHERSPNATNGSAIQGELTGSSTTAKDKVLARVMCCKATDH

>peptide 3 (32 aa)
MMNPSSCMRTASARMMIWIGCSSGSEINGNRK*

>peptide 4 (33 aa)
PSFPGGEASSSRMRPNEYSTPLAVLWTRAITMM*

>peptide 5 (31 aa)
PPSLVARHRAAECDQMSTAHHWLCSGQERSQ*

Sequence

>CNT30576811
CCCTCCTTCCCTGGTGGCGAGGCATCGAGCAGCAGAATGCGACCAAATGAGTACAGCACACCATTGGCTGTGCTCTGGACAAGAGCGATCACAATGATGT
GAGCGGCTCTCCACCTGTGGCTCTTGAAGTAGAAACCAGCACCAGACACAAATAGGCAGATGATGAACCCAAGCAGCTGCATGCGAACAGCATCAGCACG
GATGATGATCTGGATTGGGTGCAGCAGCGGAAGTGAGATCAACGGGAACAGGAAGTAGAGTATCCAGAGCACGAGCACAAGGACTGGCTTGATGCAAACA
CCACCAATAGCATACAATGTGCCACTGGTGAAGATGCACATTGTGGCGAAAGATGAAAGGAACACTGCAACCAAGCTTCCGATGGCCTGTGAGCTGGTCA
GTGCGCCGAAGCATGTGGTACATGAAAGCAGCCATGAGCGCAGCCCCAATGCCACCAATGGCAGTGCAATACAGGGTGAGCTGACTGGCAGCAGCACGAC
GGCGAAGGACAAGGTGCTTGCCAGAGTCATGTGCTGCAAGGCCACGGATCATGA