Detailed information on CNT30576807


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9LQ32|GXM3_ARATH, E-value = 1e-14

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30476032Oryza barthiiSaccharum spontaneum37.5650.185.83240forward
CNT30117078Oryza barthiiOryza nivara26.4551.6899.41169forward

Expression of CNT30576807

Peptides detected in this lncRNA

>peptide 1 (77 aa)
MSRRRCRRRRRRRFPGGGRGRRGRRSGRATWCWFPPRDSPRRGTPSSTPSPPPSRSRAPARPSPPPSPPSTSPSPPP*

>peptide 2 (53 aa)
AMDTFLCAASHLADFFTGFQLSLVLMFTLTHWAMATDIIISHQKMGVKKKTTK*

>peptide 3 (46 aa)
PWTHFYVLLRISPIFLQAFSFLLFLCSLSLIGPWPPTSSLAIKRWE*

>peptide 4 (39 aa)
HGHIFMCCFASRRFFYRLSAFSCSYVHSHSLGHGHRHHH*

Sequence

>CNT30576807
GCCATGGACACATTTTTATGTGCTGCTTCGCATCTCGCCGATTTTTTTACAGGCTTTCAGCTTTCTCTTGTTCTTATGTTCACTCTCACTCATTGGGCCA
TGGCCACCGACATCATCATTAGCCATCAAAAGATGGGAGTAAAAAAAAAAACTACCAAGTGAGTAAAAAAAGGGAGAAAAATCTATGTCGAGGCGCCGCT
GCCGCCGCCGCCGGCGCAGAAGGTTTCCCGGCGGAGGTCGCGGCCGCCGGGGACGACGAAGTGGGCGAGCGACCTGGTGCTGGTTTCCTCCACGCGATTC
TCCTCGCAGAGGAACTCCCTCGAGCACGCCCTCTCCACCTCCCTCTCGTAGTCGTGCACCAGCACGTCCGTCTCCGCCCCCTTCTCCGCCCTCGACCTCG
CCATCACCCCCGCCGTGAATATCGCCGACATCCTCCCCGGCGACGTCGTAGAGCTGGTTGGGGAGGTCGTTGATAGCGAGGCGGCAGTCGGAGTAGAGGA
GGTTCTGGACGGGGCGGCACTCGGCGGAGCGGGCGGCGCGGGCGGCGTCGAGGAGGTCGGGGAACTCGCGGACGGTGGTGGTGTAGACGACGTCGTAGGC
CTCGAGGCCCGGGTGCCGCCCTCCAGGTGGGACACGTAG