Detailed information on CNT30576801


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30117051Oryza barthiiOryza nivara99.457.0498.8498forward

Expression of CNT30576801

Peptides detected in this lncRNA

>peptide 1 (52 aa)
AIIHILGSRQPSRTPQIDQRRSFGLVCDVLLRDCFAVLFRFFSCLVWFGLVI*

>peptide 2 (32 aa)
RYHPHSRLSSAFTNTTDRSAAFVWFGLRCASS*

>peptide 3 (51 aa)
PLSSTFSALVSLHEHHRSISGVRLVWSAMCFFVIVLLFSFVFLAVWFGLVW*

>peptide 4 (29 aa)
MFLSSEISPLGCSVAVMSISFFESRSRSA*

>peptide 5 (30 aa)
MFSCSDEYLFFREQVSICLMSLGNNHLISS*

Sequence

>CNT30576801
CCGCTATCATCCACATTCTCGGCTCTCGTCAGCCTTCACGAACACCACAGATCGATCAGCGGCGTTCGTTTGGTTTGGTCTGCGATGTGCTTCTTCGTGA
TTGTTTTGCTGTTCTCTTTCGTTTTTTTAGCTGTTTGGTTTGGTTTGGTTTGGTGATCTGAGGATGGACGCCGGCGATGAGGAAGAACATGGTTCGCTCG
TCTGAACGGTGGGTTATTTACCCACCTTGCAGATTTTAAAAGTAGTCTGAGCCGATGCAAATTTCCTCTGGATTCATCGTTTTCCTTGCTGAGTTACTGG
CTTTACAGTTTTAGACCTTAAAAATCCTTTGTTTTCACTTCATGTTTCTGTCCAGTGAAATCTCTCCGTTGGGATGTTCAGTTGCAGTGATGAGTATCTC
TTTTTTCGAGAGCAGGTCTCGATCTGCTTGATGAGTCTAGGAAATAATCACCTTATTTCCTCCTGAGCGGTTACCTGAGCAACTCTTAGCACCATCCAAA
C