Detailed information on CNT30576776


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30640164Oryza barthiiNymphaea colorata20.063.4887.3271forward
CNT30317874Oryza barthiiCorylus avellana23.7334.4385.7184forward
CNT30281433Oryza barthiiChenopodium quinoa42.6614.5980.13151forward
CNT30380803Oryza barthiiManihot esculenta58.7644.3581.73208forward
CNT30398713Oryza barthiiTriticum turgidum28.5337.1393.07101forward
CNT308572Oryza barthiiZea mays29.6636.2192.38105forward
CNT30715065Oryza barthiiMalus domestica golden40.410.0682.52143forward
CNT30688530Oryza barthiiTriticum urartu59.895093.4212forward
CNT30359648Oryza barthiiLactuca sativa20.0618.2184.5171forward

Expression of CNT30576776

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MDHVREFHPISDKKDSKTTWIPQCLRASTLMHNCGEPNNNWGLNTRSTE

>peptide 2 (81 aa)
MPTSSKRKENMCRLSGWCEKKSTILQFSCILVFGLGLKAWTMSGNFIPSRIKKTAKPRGSLNVSGLPRSCTTVENRTITGV*

Sequence

>CNT30576776
GTGGAATTTGACAAGGTGAGGCTTTCCATCCTTATTGATTAGGGTGTAGGTGTTGACACCAAAACCCTCCATGTGCCTGTAGTTGAGTGGGATGCCTACA
TCGTCAAAGAGGAAGGAGAACATGTGCAGGCTCTCTGGGTGGTGTGAAAAGAAATCAACTATTCTCCAGTTCTCCTGCATATTGGTCTTTGGACTTGGCT
TGAAAGCATGGACCATGTCAGGGAATTTCATCCCATCTCGGATAAAAAAGACAGCAAAACCACGTGGATCCCTCAATGTCTCAGGGCTTCCACGCTCATG
CACAACTGTGGAGAACCGAACAATAACTGGGGTCTGAACACCAGGAGCACGGAG