Detailed information on CNT30576775


BLAST search results

BLAST vs Swiss-Prot:
sp|C0LGP4|Y3475_ARATH, E-value = 4e-20

BLAST vs NONCODE:
NONORUT005534, E-value = 4e-134

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30110144Oryza barthiiOryza longistaminata19.9429.6997.79136forward
CNT30102154Oryza barthiiOryza rufipogon92.8274.2197.31633forward

Expression of CNT30576775

Peptides detected in this lncRNA

>peptide 1 (88 aa)
SNLRGFLRNVRIRIGAIGSTRRRGVPRAAAAASPPAAGAASLPTQSSASVPISSSSVPPPAPLPLNPSPPPHLFANAASHPLFSPGSG*

>peptide 2 (56 aa)
MSGSGSGRLVRLAGEEFHVPPPPLLLQPPARPPFLPNPPPPFPSPRPPCHRRRLFR*

>peptide 3 (33 aa)
MCSVSLSSCDVEPFEVHDTQYQSFSWHVPDGGV*

>peptide 4 (40 aa)
MSSHSKYTTLSIKASHGMFQMVVYNFYGNHQTAIQLALKNF

>peptide 5 (75 aa)
VKSKGLSKKCQDQDRGDWFDSPARSSTCRRRRFSSSRRRGLPSYPILRLRSHLLVLRATAGASSAESISTSSPIR*

Sequence

>CNT30576775
GTCAAATCTAAGGGGCTTTCTAAGAAATGTCAGGATCAGGATCGGGGCGATTGGTTCGACTCGCCGGCGAGGAGTTCCACGTGCCGCCGCCGCCGCTTCT
CCTCCAGCCGCCGGCGCGGCCTCCCTTCCTACCCAATCCTCCGCCTCCGTTCCCATCTCCTCGTCCTCCGTGCCACCGCCGGCGCCTCTTCCGCTGAATC
CATCTCCACCTCCTCACCTATTCGCTAACGCCGCCTCCCATCCTCTCTTCTCTCCGGGCTCCGGCTAGATCCAAGTCGGCGTCGAGATCCAGGGCTCGGA
AACTCCTCATCTATCCAAGGATTTCAGAGATCATAGAGTTATCATCACCTAATAACAACCTCGCAATGCCAAAGTCTGCCACATGTGCCGTCATTTCATC
ATCGAATAGCACATTACTAGGCTTCAAATCACAGTGTACGACCACCTCATAGTGCTCATGGTGCAGGAGCGCTTCTAAGCTACCCTGAGGCATGTACTGA
AGAACCAATGCTCTGAACTCCAGGTTGGAGCATGTGTTCAGTATCTTTATCAAGTTGCGATGTCGAGCCATTCGAAGTACACGACACTCAGTATCAAAGC
TTCTCATGGCATGTTCCAGATGGTGGTGTATAACTTTTATGGCAACCACCAAACCGCTATTCAACTGGCCCTTAAAAACTTT