Detailed information on CNT30576747


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004032, E-value = 3e-78

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690092Oryza barthiiOryza sativa4.2687.1784.91265forward
CNT30554139Oryza barthiiOryza glaberrima38.5845.5299.792399forward
CNT30370554Oryza barthiiOryza glumipatula10.955.5396.17678forward
CNT30102331Oryza barthiiOryza rufipogon24.9932.4491.761554forward
CNT30116141Oryza barthiiOryza nivara24.9953.3592.211554forward

Expression of CNT30576747

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MGFLLGCKYVTGLGQPTHTPSFSCFALISGFVHKDAGR*

>peptide 2 (39 aa)
MNFFTGLNFLLVLASGLLRVKFLNTIIRIKISSNFALRL*

>peptide 3 (41 aa)
MNFFLWYKLLLVLTSRPWRVKFVNIKFRTKNFIQFSLHAII*

>peptide 4 (44 aa)
MLKVMQYLFIAHSCAVFFFPFFQSGCFRDRLFSICFRLGFLVFS*

>peptide 5 (46 aa)
MNSKAPPPPPPKKKKRERKKRNVLYCLLCFFKLVLFSFLRNEIWFL*

>peptide 6 (47 aa)
MYHLNHFSLDVYLLCLNISSINGASLYRACAVECLRPSYSLFNILPS*

>peptide 7 (56 aa)
MFWDCLLIAVRSLQKLHGVVFILLICQFACLGEHSGAFFMTDDPFPIFSFAIYWLA*

>peptide 8 (51 aa)
MLGFGGLPAWLSWPFTKYPFLLPNFSTIFSTNHASTISYGKATPYASALWC*

>peptide 9 (58 aa)
MGVWDSSALVRPLGLKGPGLLQYYPSIQKVLTTNLDICVSGFIFFIDRLVRLIGLIVV*

>peptide 10 (56 aa)
MFYSLFLHSLFTWLIGGIFVGMQLGLVYQPRYQSFACFTTNIEYCSERLCVSWVSA*

>peptide 11 (97 aa)
MAGAWWSTMPLRAQKYRTRGYEDLCWALVGCLPGLVGLLPNTPFFFLISLPYSPLITPQPSHMAKQRLMPQRYGAKAVVGRLNNTGFIYVNWVVLAL*

>peptide 12 (66 aa)
MGPTYIFYFYRHVGATSTPRVTKTRLILPRRRHVAPRQQNRLPKPLRESNCTGFRSLGVEISGFVV*

>peptide 13 (41 aa)
MLIRKPVSINHSKNVIFFSCGPKLRCISIRNAALKCFDYLH*

>peptide 14 (41 aa)
MAMKMYLFLSIVNFSVSLPEISLSIVLSVVVVPSKFCAIGA*

>peptide 15 (43 aa)
MLQCMLIVRQRLKRMIMRAILNHLFVLVCECDNNINGNYILRQ*

>peptide 16 (37 aa)
MGDISKLLAAASYLFTFGKQTVELCCRLEISLVLALR*

>peptide 17 (36 aa)
MLSVDCEVLTSLYCVVCEGYGLHCFVPCGIKHTLDK*

>peptide 18 (35 aa)
MKLSYLVPICCIRVTLFSHVWWTAGVHIIHTCKLC*

>peptide 19 (32 aa)
MTNGSHIYFLFLPPCRCHVNATCNKDSVNIAT*

>peptide 20 (32 aa)
MVQGIIHLHQNGICSYASSYMIPSIQVCAVNS*

>peptide 21 (42 aa)
MADVLLTVFALTVYMADWWDFCWDATGLGLPTQIPILCLLYH*

Sequence

>CNT30576747
GGGAGAAGGAAGAAGGTTTGACATGTGGGCCCCACATGTCAGTGGGCCCACATTTCTTTTTGTGTGAATGACTAATGGGTCCCACATATATTTTTTATTT
CTACCGCCATGTAGGTGCCACGTCAACGCCACGTGTAACAAAGACTCGGTTAATATTGCCACGTAGGCGCCACGTGGCGCCACGTCAGCAAAACCGCCTC
CCAAAACCGCTCAGGGAGTCAAATTGTACCGGTTTTAGGAGTTTGGGCGTCGAGATATCTGGTTTTGTAGTTTAGGGTTACGGTTTAGATTTCGATCACA
TTTGAGGGTCATGAAGTGAACTTACTCCTTTCGAGGCCCAACAGGCCGAGGCTACAAGGCTAACCCACCCACACCGAAGCCCATTAATCCTTTCCCGAAT
CTTCCCTCTCGGAAAAATCCCCAAATCGATCCGCCTCTCTCTCTCTCTCCCCTTCTCGCCGGCGGCCGGCGCGGCGCGGCGAGGCGGATTCGGCGGCGAT
TTCCTTCCTAGGGTTTGGTCTTCCTCCTCCCCTCCGGCCTCCTCTCGCACCGACGGCATCGCCCCCTCCCTTCTAGATCCCGCCTCGCCATCGAAAACCC
TAGACGGCCTCAAGCCGCCATGACCATCCCCCTTCCCACCACCCGCCACCGATGGCGGCATCGATGATAACAACCTGCGATTACCTTCATGTCGGGCGGT
TCGTTCGTCTCCCACTCCGCGGCTGACGCCCGCCGACAACAGCCGGGCGGCGACGCCTCGAGCAGGTAATCCGCGGGGTTGGGGTACCTAGGGTTAGGGT
TTGTTCCGTGAACGGGGGGGTGTCCGTTGTACGGTACCGACTCAACCACTGGCTCTAGCATCCATTAGACCATGACGATGACGGCGATATCTCCCATCAG
TTGCATGGTCCCCTTGCACAAACGCCCAGACCAAGGTGATCTCGGAACCTAATTTACATCAGATATCATTGCCTTGCACTGATTTTAGGGATTAGGGTAA
ATTAAAGGCCTTATAAATGTATGTTCCCGTGAAATCTAATCGGACCTGTTGTTTCCCATTCATGCCGTTGATTGTAGGGCTTGCTTGTTTAGGTTAGGTG
ATAAAAATTAGAAAATGCTTAAAGTAATGCAGTATTTATTTATTGCACATAGTTGTGCTGTATTTTTTTTTCCTTTTTTCCAATCTGGATGTTTTAGGGA
TAGATTGTTTTCTATTTGTTTTAGGTTGGGTTTCCTTGTATTCTCTTAGATTTGTTGGGTTTCTTATCAACAATGTTGTCTGTTGACTGTGAAGTTCTGA
CCAGTTTGTACTGTGTTGTTTGTGAGGGATATGGGCTTCATTGTTTTGTTCCTTGTGGCATTAAACATACTTTAGATAAGTAAATTAGGTTGTATTTGTA
CAATTGGTAGTATCTGCACTTTGGCCTTTTATTTGCTACTCAGTGTTGTCCGCATCATCCGATTTGTTTTGGAATTTATTGGATAAGATTAATGGGGTTT
CTGTTAGGATGCAAGTATGTAACTGGGCTTGGTCAGCCAACCCACACACCATCATTCAGTTGCTTTGCCCTAATATCTGGCTTTGTTCATAAAGATGCCG
GACGATAGCTATAGGCCATGTGCAGAGAGTGAGTAGGTGGGTCATCCATCCCACTTGCATACGTACTTACCTAGTATATGTGTAAGAGTTTCTTGTATGA
TGTTACTAATAGATGGCTATGAAAATGTACCTTTTTTTGTCCATAGTTAACTTTTCAGTGTCCTTACCAGAAATATCTTTGTCCATAGTATTGTCTGTGG
TGGTGGTCCCTTCAAAGTTTTGTGCAATCGGAGCTTAACTATCTTCTTTTACCTCTAGGTTGTGTTTTAGCAGCTGAACAAGTGCTGTAATCCTTTCTAT
ACTTCTTTCTGCCTTAATGAATAGCAAAGCCCCCCCCCCCCCCCCCCCAAAAAAAAAAAAGAGAGAGAGAAAGAAAAGGAATGTCCTATATTGCTTGCTG
TGTTTCTTTAAGTTGGTTCTGTTTTCCTTCCTTCGAAATGAAATTTGGTTCTTGTGAATCAATGTAACGTCCCTTTACACAGTATTGTTTTCTCCCAGTT
GTCTTGTGTTTTTATTTGACTTTCATATATGTAAGGGAAGGAAGAAGGCCTTAGAGACAAAACCAGTAGAAAAAGGAAAAGAAGATAGGGGTAAGCTCAT
TCTAGAACCCTAGTTGGCTTGCAGTCACCTTCTTCCTCACCGCAATGGCTGGTGCCTGGTGGAGTACGATGCCTCTTAGGGCACAGAAGTATAGAACACG
TGGGTATGAAGACCTATGTTGGGCTTTGGTGGGCTGCCTGCCTGGCTTAGTTGGCCTTTTACCAAATACCCCTTTCTTCTTCCTAATTTCTCTACCATAT
TCTCCACTAATCACGCCTCAACCATCTCATATGGCAAAGCAACGCCTTATGCCTCAGCGCTATGGTGCTAAGGCAGTGGTGGGTCGCCTTAACAACACTG
GTTTCATATATGTAAATTGGGTTGTACTTGCACTTTGACCTTTTCTTTTGCACCCTGTTGCCTTGCATAATTTGTTGGTACATGGCTGATGTTTTACTCA
CTGTTTTTGCACTCACTGTTTACATGGCTGATTGGTGGGATTTTTGTTGGGATGCAACTGGGCTTGGTCTACCAACCCAGATACCAATCCTTTGCTTGCT
TTACCACTAATATTGAATATTGTTCAGAAAGGCTCTGTGTGAGTTGGGTTTCTGCCTAGGAGCTAGGTTACCAGTTAATACTTGTGCAGCAGGCGGGAGG
ATGCCACCTAGCGCCTATCATTGCCCTAGTATGCTTTGTGGAACTTTGTCACTGGTTATATAGGTCCATGTGCAGAAAGTGTGGTAGGTGGGTCAGTCTA
CTTGCATACCTACTTTACCTTGTATGTTTGTAAGAGTTTCTTGGATGAATCTTGCTTATCCGTAGTGCAAATAGTCTGCCCCTAAAAAGAAGATTTTTCT
GTTGATATTTGTTATCCTCCATAATTAACTTCTCAGTGCCCTTATCATAGAATTATCTCCAGGGAATGCCCTATGTTGTTTGCCTCCCTTCATATGAAAA
TTGGTTGTTGTGAATCAATGTAACCCTTTACATCCAGACGTCTTTTTTGTTTGTTTAGCCCATGGTGCTGACTTTTTGTTTTTAGTTTTATGAAGCTGAG
TTATCTTGTTCCTATTTGTTGTATTAGAGTAACGCTCTTTTCACATGTTTGGTGGACAGCTGGAGTTCATATTATTCATACATGCAAGTTATGTTAATGA
CACCAAACTGGTTTAGCTTAGATCCTTGTGTCTCATTGTCTCCTTTGCAAGGCAGAAGTTCTATTTGATTAAAGCAATGCTGCAATGTATGTTGATTGTG
AGACAACGACTGAAAAGGATGATAATGAGAGCAATACTGAATCACCTGTTTGTATTAGTATGTGAATGTGACAATAATATTAATGGCAACTATATCCTTC
GTCAATAGCTGGATGAACTTTTTTTTTTGTTTTAAAAAGCAAATATAGCTCGTGTGATAGTACTTTTTATCGGTTTGGTTTATACCAATTTGTAGTCCTG
TGCCTCGTGCTTTCATGTTTTGGGACTGTCTGTTGATTGCTGTTAGGAGCCTTCAAAAGCTGCATGGTGTTGTATTTATTTTACTAATTTGCCAATTTGC
ATGTCTTGGTGAGCATTCAGGTGCTTTCTTTATGACTGATGATCCCTTCCCCATCTTTTCTTTTGCTATTTATTGGCTAGCTTAATCCAGAGTCTTATTC
TGCTGTAGCTTTTGGGGATTAAGTTAGTTTTTAGTCGCATATAGTGGAATTGACTGTATTGTTTCAGCAAGCAAGATAAATTTCCACTCTTCCAACCGTA
TTATTTATCGCAAGCAAGATAAATTTCCACTCTTCCAACTGTATTATTTATCTTTATGTAGAGCTCGCCCTCTGATTCTCGAGCGATGATCTTCTTCTCT
CCTGAACCACCTACCATCACTTAACCCAATCCACAACAAATCTGCTTTGTTCTTTTGTACTTACGGCTGGTTACGCTAGTTGTGCAGGTGTGATGTCTGG
TATATGACCAGAAGTTGCTCTGGGTGTTTGTAGTAGGGATTCGAACCGTGCCTTATTGTTTAAATGTCATTTTATTGCTTTCATGGATGGTCCAAGGTAT
CATTCACCTTCATCAGAATGGAATTTGCAGTTATGCTAGCTCTTATATGATTCCATCTATACAAGTGTGTGCTGTGAATTCATAGTATTGAGCGTTCAGA
ACTTGCTGTTCCTGTATTTATATGATGTTCCTTTTAAGCTCTTTGTATTTATATGATTTGATTAGTGAATGTATCATTTGAACCACTTTTCTCTGGATGT
ATATCTTTTATGTTTGAATATATCGTCCATAAACGGAGCTAGTCTTTATCGTGCATGTGCAGTAGAGTGCCTGAGACCCTCTTATTCTTTATTCAATATA
TTGCCGTCGTGACTTCGCAACTGAGCGTGTGTTTGGCATGAAACATCGTTCTCTTTTTTGACTTAGGCTCACTCTGAATTACTGTTGCCTGAATCTGCGT
TCAATAAGCTAATTATGTCTGGAGTCTGCTCATTCTCATGATATCCCGTTTTCTTTACCGGATATGCTTGCAGGATTGCAGGTGCATCGTCGATGGTACC
CGTTTGTAGCTTACTAAACAACGAACTATGAGTGATTGTTCATGTATTATGATTGTTCATGTATTAATTTCAGATTAAATGAATATTAATCGGCCTTGAC
GACTAAGAATAAACTGGCTGTATTTTGTTGCTGGCCCTATTGCGAGACCATGGGGGTATGGGACTCGAGTGCGCTAGTTAGGCCGTTAGGCTTAAAAGGA
CCTGGTCTTTTGCAATACTACCCCTCCATCCAAAAAGTCCTTACTACGAATTTAGATATATGCGTGTCTGGGTTTATCTTTTTTATTGACAGACTAGTAC
GTCTTATTGGGCTAATTGTTGTTTAGCTTTACTGTTGATATCCCGCTCTTCATTGGGATTTAAAATCTTGACATGGGTGACATTAGCAAATTATTAGCGG
CAGCGAGTTATTTGTTTACCTTTGGAAAACAAACAGTTGAACTTTGTTGCCGGCTCGAAATTTCACTAGTATTGGCATTAAGATAATTGTGTGTGAAATT
TGGAACAAACGTTAAAATTAGCACAAAAATTTTCATGAAAGTTTGCCTTCACTCTATAATTCGTGAGAAACAACCTTTGGGCAAAACGTGTGAGTATTAA
GCTTTGCAAAAAAAAATGCATGAATTTTTTCACTGGCTTAAATTTTTTGCTAGTATTAGCATCGGGACTGTTGCGTGTGAAATTTTTGAATACTATAATT
AGGATTAAAATTTCATCGAACTTTGCCTTAAGGCTATAAATTTATGAGATATACACTTGGGTCAAAACCCAGAAGTATTAACCTTTAGAAAAATGCACTA
TTTTTTCCTCCAACCCAAAATTTTGTTAATAGTAGCACCTATACCATACCATAACATTAGGAGAAAATTTTCATGAAATTGAGCCTCCACATTACAAGTT
CGTGAGTTGGCTTCTAGCAAAACCCACTAGTCTTAGCCTTTGGAAAAAAAAACATATGAATTTTTTTTCAATCCAAATTTTCACTAGTACTAGCATTTGG
CACTACGTGTGAAATTTGTGATTATTAACATCATAATGAAAAATTTCATGAAATTTAGCACCCACGCTGTAAATTTGTGAGTGATATGCTTATCAGAAAA
CCTGTGAGTATTAACCATTCAAAAAATGTAATATTTTTTTCTTGCGGTCCAAAATTACGTTGTATTAGCATTAGGAATGCCGCGTTAAAATGTTTTGATT
ATTTACATTAGGACAAAATATTTCATGAAATTTAGCCCCGACACCGTAAATTCGTGAGTTAGACTTCTTAAAATACCTATAAGTATTAACCTTTGAAAAA
AAACTATGAATTTTTTTCTTTGGTACAAACTTCTGCTAGTATTAACATCGAGACCATGGCGTGTGAAATTTGTAAACATTAAATTCAGGACAAAAAATTT
CATTCAATTTAGCCTCCACGCTATTATTTAGTGAGTTATAGCCTTCAAAAAAAATGGATGATTTTTTTCACTGCCCCAAAAGTATGCTAGTACTAGCATC
GAGGTTAGGTCATTGCGT