Detailed information on CNT30576737


BLAST search results

BLAST vs Swiss-Prot:
sp|Q5Z6F0|TIP22_ORYSJ, E-value = 4e-43

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691498Oryza barthiiOryza sativa14.0230.590.1661forward
CNT30673906Oryza barthiiSetaria viridis28.9719.9795.24126forward
CNT30521388Oryza barthiiSetaria italica31.2621.5295.59136forward
CNT30374836Oryza barthiiArabidopsis thaliana30.3415.7381.06132forward
CNT30712600Oryza barthiiGlycine max28.9716.8985.71126forward
CNT3042438Oryza barthiiPrunus dulcis25.2913.3783.64110forward
CNT30178846Oryza barthiiSecale cereale27.3613.3686.55119forward
CNT30589276Oryza barthiiMusa acuminata29.244.4188.19127forward
CNT30442853Oryza barthiiAegilops tauschii63.9142.993.88278forward
CNT30254829Oryza barthiiAvena sativa28.9717.7793.65126forward
CNT30142178Oryza barthiiLolium perenne61.1541.1194.36266forward
CNT30680513Oryza barthiiTriticum urartu14.2524.0390.3262forward
CNT30722694Oryza barthiiTriticum spelta37.9325.795.15165forward
CNT30352266Oryza barthiiEragrostis tef4032.8391.95174forward
CNT30619906Oryza barthiiCajanus cajan15.173089.3966forward
CNT30154895Oryza barthiiPrunus persica24.614.1782.24107forward
CNT30706772Oryza barthiiPrunus avium27.8234.4784.3121forward
CNT3022241Oryza barthiiPopulus trichocarpa26.6711.9283.62116forward
CNT30583061Oryza barthiiEchinochloa crusgalli29.223.2694.49127forward
CNT30117062Oryza barthiiOryza nivara16.5531.310072forward
CNT30113801Oryza barthiiFicus carica32.6434.3884.51142forward

Expression of CNT30576737

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MVIWPPRARPKVTAGLTWPPEMLAPMATATNSPNPWHTA

>peptide 2 (56 aa)
MAKWVIRTRCWQRGRGRRTWGRPSRSRCWCSRRWRRRGRRSAPGSWSRRRRGRRRG*

Sequence

>CNT30576737
GCCTTCTTCCCCATCTGAACCAAATCAATCCTTCACAACACATCCTCACAAGATTCTGACGATGGAGTGACCATTTTTATGCGTGTTGCCGATGGCGAAA
TGGGTAATTAGAACTCGCTGCTGGCAACGGGGGCGTGGTCGCCGCACATGGGGCCGACCCAGTAGATCCAGATGTTGGTGTAGTCGCCGCTGGCGACGGC
GGGGCCGAAGGAGCGCGCCGGGTTCATGGAGCCGCCGGAGAAGGGGCCGGCGACGAGGATGACGGCGCCGACGATGGCGCCGAGGAGCTGGGCGACCCAG
TAGAAGACGCCGGTGAGGATGGTGATCTGGCCGCCGAGGGCGAGGCCGAAGGTGACGGCCGGGTTGACGTGGCCGCCGGAGATGTTGGCGCCGATGGCCA
CCGCCACGAACAGCCCGAACCCGTGGCACACCGCC