Detailed information on CNT30576731


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005507, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692082Oryza barthiiOryza sativa34.3610.1487.46279forward
CNT30553953Oryza barthiiOryza glaberrima10093.6699.75812forward
CNT30370421Oryza barthiiOryza glumipatula92.9895.2199.47755forward
CNT30108006Oryza barthiiOryza longistaminata33.6211.8292.31273forward
CNT30102134Oryza barthiiOryza rufipogon92.9895.0999.47755forward
CNT30115613Oryza barthiiOryza nivara93.2395.799.47757forward

Expression of CNT30576731

Peptides detected in this lncRNA

>peptide 1 (72 aa)
AQQNITHLLPLLFFFSRSLPLPHAPPSAAASQAVPSLSPAPAATPHSGDPSSRRPATVAGLNRFLGSSLLCP*

>peptide 2 (39 aa)
MLESWACVPSKRQMRHSWWIPAKNLYLNLQVVGEVVLAL*

>peptide 3 (50 aa)
PTKHNPPSSSSFFFFSFSSSPSRSTQRRCFPGSAVALPCACCHAPLRRPF*

Sequence

>CNT30576731
GCCCAACAAAACATAACCCACCTTCTTCCTCTTCTTTTTTTTTTTTCTCGTTCTCTTCCTCTCCCTCACGCTCCACCCAGCGCCGCTGCTTCCCAGGCAG
TGCCGTCGCTCTCCCCTGCGCCTGCTGCCACGCCCCACTCCGGCGACCCTTCTAGCCGCCGCCCCGCAACCGTCGCCGGCCTGAATCGGTTTCTTGGCTC
CTCGCTTCTCTGCCCCTAAGCTAATCCCAGCCACCGGTCTCTTGCTGCTGCAGCCGCCGTGGAGATGGCCGGTGGAAACACAGCGCACGCAACTCCGGTG
GCTGCATCCCTTTCCCCCATAGATTACCTTGTTTGATGGTCCTACTGTGGTTGTGGAAGACTGATGATCATGTGACTCTCTGGTTCTACAGCTTCTTCTG
AAATTGGAAGAATGCATGCTTGAATCCTGGGCGTGCGTCCCGTCGAAGCGACAGATGAGGCACTCTTGGTGGATACCTGCGAAGAACCTTTACCTGAATT
TGCAAGTCGTGGGGGAGGTGGTTTTGGCGCTGTAAAAACTCCGGATGCAACTGGTCGCTTGCTCGTTGGTGGAGGCGCCCAGAAAGAGATAGGCTCGGGT
AGCCTCTAAGATGGCTTTGCCCGCGGCGTGTGTGTGCTCGCCTTGTTCTTAACCTGTTGATCACCCCCTGCAATTACTTCTCTGCAAGCATAGCAAACTG
AAACAACTGGTTGACAGTTTTAAATTCCTTATTATCAACTATGTCCTGAATTTCGCACCTCAATTCCGAGTAAAAATGACAAATAGAATCTTCGGTTCCC
TCCACCATTGCT