Detailed information on CNT30576727


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30108675Oryza barthiiOryza longistaminata67.4699.1798.6713forward
CNT30102051Oryza barthiiOryza rufipogon100.1978.599.341059forward
CNT30116964Oryza barthiiOryza nivara100.1987.0299.061059forward

Expression of CNT30576727

Peptides detected in this lncRNA

>peptide 1 (76 aa)
MCRPGSSSPHNPPAGLDLPSLSGAPAACLLSLLSSRGWGPSGRPPPRYRASLSSSRKMQVVDPGYCSSWSWVTCFC*

>peptide 2 (38 aa)
MNMCICLVVVFGELGCYVQQYFSLFSPYHENMCIVSHV*

Sequence

>CNT30576727
GTGGCTAGTGGAGCTGTTGAGCACCGACGCCCCTGGCTAGGAACGGCGGCAGATCTGGCGGCTCGGTGCGAAAGCTGAACGGCGGCAGTTACAAGCCCGG
CCGTCCTCCAGGCGCGGTGATCCTCCACCGCCGGCCGACCTCATCCCCATCCTTTCTCCCGCCGTCTGGTCGCCGCTATTTGAGGTGCGCCGGGTGGTGG
CTCGGTGGAGCGGTTGAGCGACGGCTGTCGGCTAGGAGCAGCGACAGATTTGGAAGCTCGGTGCAGAAGGTGAACGGCGACGGTGACAAGCCGGCCGTCC
TCCATTCGTGGCAATCCATCACCATCGGCCAACCTCATCCCCGTCTTCTCTCTTGCCGTCTGGTCGTCGCCATTCGAGATGTGTCGCCCGGGTTCGTCGT
CGCCGCATAATCCACCTGCCGGCCTGGATCTGCCCTCCCTCTCTGGCGCACCTGCCGCTTGTCTCCTCTCACTGCTGTCGTCGAGGGGATGGGGCCCTTC
CGGCCGCCCTCCTCCCAGGTATAGGGCGTCACTATCCTCATCCAGGAAGATGCAGGTGGTTGATCCTGGCTATTGTTCTTCGTGGTCGTGGGTAACCTGC
TTCTGCTGAGGAGAAGATCTGGAGATTCTCATGTCCTTTTGTCTCAGTTCTGGATTGCTGCAACAATGTGTCTATGCTTGCATTTTCTTGATCTAGATCT
CGAGGCGAGACCGTACTGGTGTTATTGCATTTAATTTGTTTTTTTTCCCGATTCTTGGGTAAATGCTTCACTTGGGCTTGTTGAGTTTCCAGGAAAGAGA
TCCAGGAGGGGAGCACTTTGTGGGGTGATTTATCCTTGATTCTAAAATGGGAGGATAGCTGGCACCAGCTTGGTGGTGGTGTTTTTCTTGGATCACGATG
AATATGTGTATTTGTCTAGTTGTGGTGTTTGGCGAGTTGGGATGTTACGTGCAGCAGTATTTTTCTCTTTTTTCCCCTTATCATGAGAATATGTGTATTG
TCTCCCATGTGTAATTTTGTTGGTCACTTGATAGAACAAAAATTCAATTATTATGAC