Detailed information on CNT30576723


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000044, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694361Oryza barthiiOryza sativa55.8765.9997.582317forward
CNT30555766Oryza barthiiOryza glaberrima26.0431.8691.391080forward
CNT30104116Oryza barthiiOryza rufipogon33.2849.8991.521380forward

Expression of CNT30576723

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MSATALSSNTYGSTPLLPILIVLVVSGHHGGGTL*

>peptide 2 (39 aa)
MTFFNRHKRFWASVVQPRSNLCDEIKCHIWLPHAGQHGR*

>peptide 3 (39 aa)
MXRRSRXLKLYQPTDPGLDTVKHVGFRIISFGTRQYKSA*

>peptide 4 (44 aa)
MLCLRQLSPPTRTAAPRYYLFSLFLLSLATMVEALFSGVAKVSR*

>peptide 5 (52 aa)
MVFRASDNQVAYLGFICVGARQVIISSPLSIIILYSIALFYALAIHDFECIT*

>peptide 6 (55 aa)
MRAAREHAWPPTSPPSSHRSAAAPLAFSFLFSRLSMEEKKRRKEEEEKKKRKESP*

>peptide 7 (57 aa)
HPSELSLSXFSLLHDRPPPLPPADLLFHSPTSQTLAPLALSRRGESVFPLSPFSPTP*

>peptide 8 (63 aa)
MGTDLVIMLINNVVPLYSGSYISPREGGKLMPRRANVIFTEAQVNILIILRSLCVYIVKTWLR*

>peptide 9 (65 aa)
IHPSYLSLXSLSSMTGHHHCHRPISSSTALHPKPSRHWLCLGEVNPFFPFPPSLPPHSNHNRHLL*

Sequence

>CNT30576723
CCATCCATCCGAGCTATCTCTCTCTTTNTTCTCTCTCCTCCATGACCGGCCACCACCATTGCCACCGGCCGATCTCCTCTTCCACAGCCCTACATCCCAA
ACCCTCGCGCCATTGGCTTTGTCTCGGCGAGGTGAATCCGTTTTTCCCCTTTCCCCCTTCTCTCCCACCCCATAGCAACCACAACCGCCACCTCCTCTAA
CCAACCGAAGCAAGCTTTTACGCTCGCCGTTCCGGCCTCTTCCCTAACTCCCTGTGCCGGCCACCACCCTCCTCGGATGCGTGCTGCTCGGGAACACGCG
TGGCCGCCGACGTCGCCGCCCTCCAGTCACCGGAGCGCCGCCGCGCCGCTCGCCTTCTCCTTTCTCTTCTCTCGGCTCTCTATGGAAGAGAAGAAGAGAC
GGAAGGAAGAAGAAGAGAAAAAGAAAAGAAAAGAATCTCCCTGACAGGTGGGCCCATCAACAGTAGCCTTTCATATTTTTCTTATTTAATTCAAATCCCA
ATTTTAGAAGCCCATATCTCCTAAACCGTAGATCCGATTCCGATGAAACTTGGACCTAAATTCATGTAAATTCAAAAGCTATATTTTGATATGAAATTTG
CTATTTTAATATTTTATTTGAATTTCCTTAATTTATTCAAATACCATTTGAATAAACATTTGATTTAATCTTACATTTGAATTTCCAATTGAAACTTATA
TTCACCTTTCAAATATTTCCTTTTATTTTCAAATTACCCTTTGCCATTAAAATAACCACCGTTTGGAACTTTACGCCTTCCATAGGGACGTTCGCACGGT
CTTCTGACCCCGACGTCGAACCGTTGCTTGTAAAGTCCGACAAAACCCAAACCCAAGGTCGAAGTGCTGCTCCTGACACCTTACGCTTCAATGCAGAGCT
TCACTATTCCCTCGACCTCCACAGCACGCCGCACAGTTATCTTTTAAGCTCTGTGTGATCCTAGCCGCTCCGCCGCCATTCACGGTTGTCGGAGTAACAC
CTCCACCCCATTAAACCTATACCCACCTCCTATTCTTCTAGCCGATATGTTGTCTATCGACACCAGCTAAAAACGACACCAAACCTAGTCGTCATACTAC
CCAATTCTAATGACAACTAGCAAACACCCAAATCCCAGCCGATATTCATCCTACCGCGATATCGGCTTAATCAAATGAAACCCTAGCCAGCCAGTCTGCT
ATCCAAACTCCATACCAGCCATTTACCATCCAACTACCTATAGCTTAAACATGAAATACGAGCCGATATGCTATCCTATTTCAGCATCGACTCGAGAACA
ACTAAACCCTAGCCACTATTCCACCAAAGCCTAATCTTGATCCCCTCTCCAACCTAGCCTCCAACCCCTTAGAGCCTACACATAAAATACTAGCTCAATA
ACCCATCAAGGAGATAATTATACCCCAAACCTAGCCTTTCTCGCTCTTCATCATTTTCTTGCTATTTTATAGCTTTTATTGAATTTGGTTCTTCCTTTTC
TTTAATAGAGTCTATTTTATTCTGGATGGCAACCTATGGTATTTCGAGCATCGGATAATCAGGTTGCCTATCTCGGATTTATTTGCGTTGGAGCAAGGCA
AGTTATTATTTCCTCTCCTTTGAGCATAATTATCCTATACTCTATAGCTTTATTCTATGCATTAGCCATTCATGATTTTGAATGCATAACTTGAACATAT
AGCAAACCAGATATATGCTAGATTTTGCTTAGCCCTGCTTAGTTAGAATATGCATAAAATTTAATGAACTTAGATTGGGACAGTACGTAAGATTTGGTTG
ATTTCCGGGTGGCTAGTACTGTCTCGATCGATATAATTGCCACCAAATACTTATGTCAAACGAACAAGTACGACCGCAGCTTCTAGAATGGGGACAGACC
TAGTTATTATGTTAATTAACAATGTGGTACCTCTGTATAGTGGTTCTTATATAAGTCCTCGCGAAGGAGGCAAACTTATGCCGCGAAGGGCAAATGTGAT
ATTTACCGAGGCGCAGGTAAATATCTTGATTATATTGCGATCGCTGTGTGTGTATATTGTGAAAACCTGGTTGAGATGACGTGGGGTCTCTCATCCAGTT
CTCTCTTAAAACCTCGAGAACGCCAGAACTCCTCTCGCTGCTGATAACGTTACGTTCAGAGCGCATAGGGACTAGTGTTCATGGAACAGGTGCCACTATT
GTTANTAACCTAANNCTNGGCNANGACTAAGCTAATGAATATTGGCAAGTCGTGGACTGCGGGTAAAGTGTACATCTACTGCAGTAGAGTATTCATGAAA
CTATTCGAATAGCCGTGCTCACAGAATTGAGTATCGGGACTCATGGTATTTGGTTAGAAACTTAACTCAAGATTTTACTAAATACTGTTGCATAAAGACA
TCCCAGGCTTTCTTCCTCTTTATTCTCAGCTTTCTGCCAGTAAACCTAGATCTACTTAAATACTACTTCATGCATTCATTATTTGATATAATAGCTTGCT
AAGTACGTTGTACTCACCCTTGCTTCAACCCCCCCCCCCCTTTCAGAGTCTATTTGGATCAGTTCTTGCTGATGCTGGGAGTTCAATCACATAAGTTAAT
TCCCTTTTAACTTAATCTTCAAGTCTAGGTAATTTAAATGGTTTAAGTCTATGGTAAAACAACAGAGTTAGGTTATTCTAAAGCTTCTGTTGTAATAGTT
AGCCACAANCTCGTAAATACCCTATTACTTTATGTAATAATATCTCCTTCAAAGCTATNTCTAAANNTATGCANAGACGATCCAGATTNTTGAAGCTGTA
TCAACCTACTGATCCAGGGCTTGATACAGTTAAACATGTCGGTTTCCGAATCATTAGTTTTGGGACCCGACAATACAAGTCTGCATGACGAAATTGCATG
TCGACCCGTAGCTTAATATATAAAACGAGCTAGCCCGGTGCTGCGCGCTCCCGTCGCGATCTCCTCGTGGGACCACTCCCATGCTATGTCTGCGACAGCT
CTCTCCTCCAACACGTACGGCAGCACCCCGCTATTACCTATTCTCATTGTTCTTGTTGTCTCTGGCCACCATGGTGGAGGCACTCTTTAGTGGCGTAGCC
AAGGTTTCAAGGTAGGGTGGTCCAACACAACATAATATTTTTTTAATACCCTAGATAAAATTTACCAAACGCATTTAGGTTAAACAATAAAGACATTATA
AACATTTTGAGATAAACAAGTCTAGTATTTACTTAAATGTAACTTACACATCCACGATAATTGAAGAAGAAAATAGAACTAGTTCTAGTTCTTTTTGTCG
GTTTTGAGCCTTTGGCCATAAAGTGTTGGTTGTATCAATTTACATACCAATACTATTCGGAATACTAAAAATCAAAATAAAATTGAACCTAAATCAAAAT
ACCTAGGGTTAGGCCTAATGGCTGCTGGCTGCTGACCTAAATCAAAAAAAAGGAGAAAGGAGAGAAGAGAAACACTACAAGAATCTATTTAATCTATGAC
GATAAAAATTCGTCATGGATCGCTGAAAATTTGTCACAGAAATTTGTCTATGATGATTGTACTTATCTTCATCTATTGAGCATCACAGATTAAATCTGTC
AACGTTTTCTCTGAAATTGTCACGGATCAGCACAATCTATGACGTTTTTTAACCGTCATAAACGCTTTTGGGCTAGTGTAGTCCAGCCCAGGTCCAACCT
TTGTGACGAAATTAAATGTCACATATGGTTGCCACATGCCGGCCAGCATGGCAGGTGACGTGGTCGTTGACACGTGTGTGATAACATGTCACTGATGACG
TGGCAGCTAAACGCCAGCAAATATTTTTAAACGGCCCATTATTTTTTATGGCCCATTAATTATTTAACAGCGGCCCATTATTTTTTTAGAACTGGCCCAC
AAAATATACATATCTCTTGTATAGTTTATAAACTATAAGAGAGAGATGTAAATTTTGTGAACAATATTACAAATCACTTTGTCAGATGAAGAAATGACCC
AAATAAAAGCTATAGATATTGATGAGTTATACAACTTTGTTGTTGATGATTATTTCAGTTGAAATCATCTCGTACTTGTAAATATTGTTTAAAGCTATCA
TAATTTGAAATTCAAATTTAAACTGTTTAAACAAAGTCATATAGAAA