Detailed information on CNT30576707


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30576707

Peptides detected in this lncRNA

>peptide 1 (71 aa)
QIHYNKQTTGSFVSHPYTAILINHSICRSQALQGAATFSLASGAISSPSIPGALPATPRPRSTFSQFFAGP*

>peptide 2 (58 aa)
MYRLTLTLRRPMWKPVLPSMTVSTSPPVDAQAQGWRNQQGKSSCICIALHKDEIEQSN*

>peptide 3 (49 aa)
MQFLTISSYAGVPTTLMARFRVAATFFTSLGSTTLHCQKNHITSNHVNV*

>peptide 4 (43 aa)
MEIVYRSVSHPLQLDESTGLEAAGDGEHVGSGHDEMSKRRVELH

>peptide 5 (80 aa)
MLQTINHHQHQTGEVLVHAVPDHLLVRRRADDLDGALQGGRHLLHVAWLHHLALPKKPYNQQPCKCVVVYRLIGIRMCHI*

>peptide 6 (44 aa)
MKSNNRIDRWKLYTVPYLIPCSWMSPQGSKRLGTASTSAPAMMR*

Sequence

>CNT30576707
TACAAATTCACTACAACAAACAAACCACTGGTTCATTCGTCTCTCATCCATATACTGCTATATTAATTAATCACTCCATATGTAGATCTCAGGCTCTTCA
AGGAGCAGCCACGTTCTCCTTGGCGAGCGGCGCGATCTCGTCGCCTTCGATCCCCGGCGCGCTGCCGGCGACGCCCAGGCCCAGGAGCACATTCTCCCAG
TTCTTCGCAGGCCCCTGAAATCCATGTTGCAAACAATTAATCATCATCAGCATCAGACAGGAGAGGTCCTGGTTCATGCAGTTCCTGACCATCTCCTCGT
ACGCCGGCGTGCCGACGACCTTGATGGCGCGCTTCAGGGTGGCCGCCACCTTCTTCACGTCGCTTGGCTCCACCACCTTGCACTGCCAAAAAAACCATAT
AACCAGCAACCATGTAAATGTGTAGTAGTGTACCGACTTATCGGTATTAGGATGTGTCATATCTGATTGTTATGTAAATGTATAGGCTTACGTTGACGCT
GAGACGGCCCATGTGGAAACCAGTCTTGCCTTCGATGACCGTGTCCACGAGCCCACCGGTGGACGCGCAAGCACAGGGCTGGAGAAATCAACAAGGAAAA
TCATCATGCATTTGCATTGCATTGCACAAAGATGAAATCGAACAATCGAATTGATAGATGGAAATTGTATACCGTTCCGTATCTCATCCCCTGCAGCTGG
ATGAGTCCACAGGGCTCGAAGCGGCTGGGGACGGCGAGCACGTCGGCTCCGGCCATGATGAGATGAGCAAGCGGCGCGTTGAACTTCACC