Detailed information on CNT30576681


BLAST search results

BLAST vs Swiss-Prot:
sp|Q5Z6F0|TIP22_ORYSJ, E-value = 1e-39

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30674263Oryza barthiiSetaria viridis12.5626.6494.5273forward
CNT30223457Oryza barthiiHordeum vulgare20.3139.693.22118forward
CNT30397893Oryza barthiiTriticum turgidum28.5726.0695.18166forward
CNT30589165Oryza barthiiMusa acuminata23.4129.6991.18136forward
CNT30553963Oryza barthiiOryza glaberrima71.0858.7599.76413forward
CNT30443838Oryza barthiiAegilops tauschii28.0633.8294.48163forward
CNT30256642Oryza barthiiAvena sativa23.9226.9996.4139forward
CNT30229576Oryza barthiiAnanas comosus28.0622.8984.05163forward
CNT3066802Oryza barthiiLeersia perrieri20.1449.3790.6117forward
CNT30364799Oryza barthiiSorghum bicolor24.7818.9295.14144forward
CNT30596416Oryza barthiiOryza meridionalis79.52101.7695.67462forward
CNT30370544Oryza barthiiOryza glumipatula72.4649.7698.57421forward
CNT30644098Oryza barthiiCannabis sativa19.9741.4383.62116forward
CNT30101982Oryza barthiiOryza rufipogon95.35101.6597.47554forward

Expression of CNT30576681

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MAKWVIRTRCWQRGRGRRTCRRTGRRGRRGCWRRR*

>peptide 2 (53 aa)
MLAPTMKPMAMGAMVPSDPFLGSAAVAYTVYTSPKVTMISITTPSNAPTPDSPC

Sequence

>CNT30576681
TTTTATTTCTGATTTCCTATTTGCGAGGAGAAGACACAAGCTTATTTTGGAGGCTACAAACAAACTGAAATGACATGGCCCGAATCAAATGAAATCTCAC
AATAAAACTCAACAGAAGTGTTCGATCTTAAACATGCATCTCATCCAACTTGCTCCACACTGATCACATTACAAATTAATCAAGAAGAAACTAAACATGG
ATCGATCATCACCCAAGTGTCACATCCTCGCAACAAAAGCCTTCTTCCCCATCTGAACCAAATCAATCCTTCACAACACATCCTCACAAGATTCTGACGA
TGGAGTGACCATTTTTATGCGTGTTGCCGATGGCGAAATGGGTAATTAGAACTCGCTGCTGGCAACGGGGGCGTGGTCGCCGCACATGTAGACGTACCGG
TAGACGAGGCCGGCGAGGATGTTGGCGCCGACGATGAAGCCGATGGCGATGGGCGCGATGGTGCCGAGCGACCCCTTCTTGGGGTCGGCGGCGGTGGCGT
ACACGGTGTACACCAGCCCGAAGGTGACGATGATCTCCATCACCACGCCCTCGAACGCGCCCACGCCGGACAGCCCGTGCG