Detailed information on CNT30576679


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONBNAT004661, E-value = 4e-149

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696475Oryza barthiiOryza sativa67.8113.9198.03356forward
CNT30676938Oryza barthiiSetaria viridis70.2938.493.22369forward
CNT30524664Oryza barthiiSetaria italica67.4325.8697.18354forward
CNT30641660Oryza barthiiNymphaea colorata68.7629.7994.18361reverse complement
CNT30536068Oryza barthiiEucalyptus grandis63.629.794.61334reverse complement
CNT30378667Oryza barthiiArabidopsis thaliana33.3315.6496.57175forward
CNT30500477Oryza barthiiCoffea canephora63.6218.3495.51334forward
CNT30269781Oryza barthiiChenopodium quinoa63.6211.394.61334forward
CNT30730500Oryza barthiiCorchorus capsularis63.6228.1495.51334forward
CNT30525072Oryza barthiiPhaseolus vulgaris39.0548.0196.59205reverse complement
CNT30196411Oryza barthiiPisum sativum63.6226.492.81334forward
CNT30503431Oryza barthiiNicotiana attenuata63.6224.1995.51334reverse complement
CNT30709956Oryza barthiiGlycine max48.3856.5790.94254forward
CNT3044711Oryza barthiiPrunus dulcis53.959.3394.7283reverse complement
CNT30187663Oryza barthiiSecale cereale69.931.3797.82367forward
CNT30291213Oryza barthiiTriticum aestivum70.2910.6297.83369forward
CNT30221722Oryza barthiiHordeum vulgare40.5721.7397.65213reverse complement
CNT30400299Oryza barthiiTriticum turgidum67.8116.6997.47356forward
CNT30588765Oryza barthiiMusa acuminata61.7146.4294.44324reverse complement
CNT30248027Oryza barthiiAvena sativa70.2937.8995.93369reverse complement
CNT30310298Oryza barthiiCamelina sativa63.0521.794.56331reverse complement
CNT3062651Oryza barthiiArabidopsis lyrata57.7136.4294.72303reverse complement
CNT3018333Oryza barthiiZea mays70.2912.9297.83369forward
CNT30655263Oryza barthiiRosa chinensis63.6218.591.92334forward
CNT30206293Oryza barthiiHelianthus annuus63.6215.295.51334forward
CNT30689043Oryza barthiiTriticum urartu70.2918.3597.83369forward
CNT30720907Oryza barthiiTriticum spelta70.2936.1497.29369reverse complement
CNT30596725Oryza barthiiOryza meridionalis70.2910.6998.1369forward
CNT30357533Oryza barthiiLactuca sativa63.6232.8194.01334forward
CNT30154922Oryza barthiiPrunus persica63.6219.7889.52334reverse complement
CNT30412183Oryza barthiiPapaver somniferum63.6211.8694.91334forward
CNT30646402Oryza barthiiCannabis sativa63.0526.1791.84331reverse complement
CNT3056240Oryza barthiiAmborella trichopoda48.5789.1692.55255forward
CNT30319706Oryza barthiiAsparagus officinalis68.7612.5695.29361forward
CNT30332807Oryza barthiiDioscorea rotundata68.7621.8595.01361reverse complement
CNT30148090Oryza barthiiBrachypodium distachyon70.2912.797.83369reverse complement
CNT30102893Oryza barthiiOryza rufipogon70.4826.2496.22370forward

Expression of CNT30576679

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MPLEPRASWFSPKCVEAQQLTGHLGVKHCFGAGCARTAKSTTVR*

Sequence

>CNT30576679
ACAAGCAGTGGGAGGGGAAAGTGATCTTTGACCGCGTGCCTGTTGAAGAATGAGCCGGTGACTCATAGGCAGTGTCTTGGTTAAGGGAACGGAACCCACC
GGAGCCGTAGTGAAAGCGAGTCTTCATAGGGCGATTGTNACTGCTTATGGACCCGAACCTGGGTGATCTATCCATGACCAGGATGAAGCTTGGATGAAAC
TAAGCAGAGGTCCGAACCGACTGATGTTCAAGAATCAACGGATGAGTTGTGGTTAGGGGTGAAATGCCACTCGAACCCAGAGCTAGCTGGTTCTCCCCGA
AATGCGTTGAGGCGCAGCAGTTGACTGGACATCTAGGGGTAAAGCACTGTTTCGGTGCGGGCTGCGCGAGAACCGCCAAGTCGACAACAGTTAGATAGGC
TACCCCAAACATTGTACTGGTGTGATTATGGTGAATAAGAGCAACGACTGGCTTCGGCCAACAGGATGTAGGGTTATTACCTGACAATTTAGGGGCCCAA
ACCTGTATAAAAATCTTTGTCTCCG