Detailed information on CNT30576665


BLAST search results

BLAST vs Swiss-Prot:
sp|P43214|MPAP2_PHLPR, E-value = 5e-19

BLAST vs NONCODE:
NONORUT005905, E-value = 5e-105

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694549Oryza barthiiOryza sativa100.1955.3398.15540forward
CNT3067584Oryza barthiiLeersia perrieri46.3831.8181.6250forward
CNT30370518Oryza barthiiOryza glumipatula83.6759.8190.47451forward
CNT30107145Oryza barthiiOryza longistaminata41.7453.0796.89225forward
CNT30102178Oryza barthiiOryza rufipogon71.9948.5696.39388forward
CNT30116939Oryza barthiiOryza nivara10087.596.47539forward

Expression of CNT30576665

Peptides detected in this lncRNA

>peptide 1 (57 aa)
MATLVTSSRLFPLEPSPTLKVTSVAHEPTTNNAAIATASRKEDNEAIGELASFLVLSF

Sequence

>CNT30576665
CCTTATTTTACCACTGGCTTATTACCACAAAATAACCACAAGAAATTAATTGTTTGCTTGCTCACGCATAGCGTGATCTCTTTCTAAGACAAAATTATTA
GAGGTTAATAATTATCATGCAACCCAATGCAAGAGTACGCATATCTATTAATTAGACGTTGATACCACTCTTGTATTCAGAGCCGGCCGTAAAGCTTTCG
GGGATGACGTCGTCGACGACACGGTAGCCGCCGTTCTTGACAAGGAAGCGGACGGAAAAGGGGCCCTTGAGCGCCGCCTCACTCTTGAGCGACCAGGTGT
TAGTCGACGACTCCTTGAGCGCCACCCAGTCCTTGCCGCCCTTCTCCTTGATCTCCACCTCAGAGATGGCGACGTTGGTGACGAGCTCTAGACTTTTTCC
GCTAGAGCCCTCACCGACCTTGAAGGTGACCTCAGTGGCGCATGAGCCGACGACCAACAATGCCGCCATTGCCACGGCGAGCCGGAAGGAGGACAACGAG
GCCATTGGCGAGCTAGCTAGTTTCTTGGTGTTATCTTTC