Detailed information on CNT30576658


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9LHP4|RGI1_ARATH, E-value = 3e-07

BLAST vs NONCODE:
NONORUT005534, E-value = 8e-135

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30116896Oryza barthiiOryza nivara60.2271.0998.47327forward

Expression of CNT30576658

Peptides detected in this lncRNA

>peptide 1 (88 aa)
SNLRGFLRNVRIRIGAIGSTRRRGVPRAAAAASPPAAGAASLPTQSSASVPISSSSVPPPAPLPLNPSPPPHLFANAASHPLFSPGSG*

>peptide 2 (33 aa)
MCSVSLSSCDVEPFEVHDTQYQSFSWHVPDGGV*

>peptide 3 (56 aa)
MSGSGSGRLVRLAGEEFHVPPPPLLLQPPARPPFLPNPPPPFPSPRPPCHRRRLFR*

>peptide 4 (75 aa)
VKSKGLSKKCQDQDRGDWFDSPARSSTCRRRRFSSSRRRGLPSYPILRLRSHLLVLRATAGASSAESISTSSPIR*

>peptide 5 (40 aa)
MSSHSKYTTLSIKASHGMFQMVVYNFYGNHQTAIQLALKNF

Sequence

>CNT30576658
GTCAAATCTAAGGGGCTTTCTAAGAAATGTCAGGATCAGGATCGGGGCGATTGGTTCGACTCGCCGGCGAGGAGTTCCACGTGCCGCCGCCGCCGCTTCT
CCTCCAGCCGCCGGCGCGGCCTCCCTTCCTACCCAATCCTCCGCCTCCGTTCCCATCTCCTCGTCCTCCGTGCCACCGCCGGCGCCTCTTCCGCTGAATC
CATCTCCACCTCCTCACCTATTCGCTAACGCCGCCTCCCATCCTCTCTTCTCTCCGGGCTCCGGCTAGATCCAAGTCGGCGTCGAGATCCAGGGCTCGGA
AACTCCTCATCTATCCAAGGATTTCAGGAGCGCTTCTAAGCTACCCTGAGGCATGTACTGAAGAACCAATGCTCTGAACTCCAGGTTGGAGCATGTGTTC
AGTATCTTTATCAAGTTGCGATGTCGAGCCATTCGAAGTACACGACACTCAGTATCAAAGCTTCTCATGGCATGTTCCAGATGGTGGTGTATAACTTTTA
TGGCAACCACCAAACCGCTATTCAACTGGCCCTTAAAAACTTT