Detailed information on CNT30576633


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694484Oryza barthiiOryza sativa95.2188.1799.16477forward
CNT30673601Oryza barthiiSetaria viridis12.9723.0592.3165forward
CNT30398657Oryza barthiiTriticum turgidum10.9822.1892.7355forward
CNT30554101Oryza barthiiOryza glaberrima10078.28100501forward
CNT30140884Oryza barthiiLolium perenne19.3627.1790.7297forward
CNT30368472Oryza barthiiSorghum bicolor19.3622.7291.7597forward
CNT30370564Oryza barthiiOryza glumipatula96.6110097.11484forward
CNT30102264Oryza barthiiOryza rufipogon100.673.6899.01504forward
CNT30117076Oryza barthiiOryza nivara90.6289.994.93454forward

Expression of CNT30576633

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MSHLKIHLSNYLFVLLSTHETLAYLYTSLKLTIVLYLPMRH*

>peptide 2 (46 aa)
MLADDNGKSNLGTSGSLTVETRHWLHHNTHQWRQQGALSVIGREKK*

>peptide 3 (47 aa)
MMMDRLTRHRLHPAIPKTIFNFITFRFENVTLENTSFKLPICSSVYP*

Sequence

>CNT30576633
GAATTAGCAACAATTTAATCTAACATACGCAAACTGATATTATCACAATGTTAGCCGATGACAATGGAAAGAGTAATCTAGGTACAAGCGGATCATTGAC
GGTGGAGACAAGACATTGGCTGCACCACAACACCCACCAGTGGCGCCAACAAGGAGCGCTATCCGTTATAGGACGAGAGAAAAAGTAAAACATCACGATG
TGAAGTGAAACTGAATAATTCTAGTAGACGATGATGATGGATAGGCTCACTCGTCATCGTCTTCATCCTGCAATCCCCAAAACCATTTTTAATTTCATCA
CTTTCCGTTTTGAGAATGTCACACTTGAAAATACATCTTTCAAACTACCTATTTGTTCTTCTGTCTACCCATGAGACATTAGCCTATTTGTATACATCTC
TCAAACTAACTATTGTTCTATATCTACCCATGAGGCATTAGCCTAATCAAAGTGTGAATCGTACTCCTAATCGTACAAGCCTCAGGCATAGTCAGCTAAG
C