Detailed information on CNT30576628


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005669, E-value = 4e-179

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696163Oryza barthiiOryza sativa99.2323.6297.42388forward
CNT30554971Oryza barthiiOryza glaberrima84.9169.1799.1332forward
CNT30596307Oryza barthiiOryza meridionalis99.2349.1898.71388forward
CNT30370387Oryza barthiiOryza glumipatula93.6168.4198.36366forward
CNT30102296Oryza barthiiOryza rufipogon99.2376.3898.71388forward
CNT30117538Oryza barthiiOryza nivara10088.8697.7391reverse complement

Expression of CNT30576628

Peptides detected in this lncRNA

>peptide 1 (45 aa)
MPLGVLKIKGMLFMTMTCIMEDGMSRCMQGIGLVALSVNLEYWST*

>peptide 2 (29 aa)
MYAGDWSSSFVSEPGILEHLVTKVLLAPA*

>peptide 3 (45 aa)
LDANISGQASELSGGLEDQYYAPWCAENQGDVVYDYDMYYGGWDE*

Sequence

>CNT30576628
TTTAGATGCAAACATTTCTGGGCAAGCCAGTGAGTTAAGTGGTGGGTTGGAGGATCAGTACTATGCCCCTTGGTGTGCTGAAAATCAAGGGGATGTTGTT
TATGACTATGACATGTATTATGGAGGATGGGATGAGTAGATGTATGCAGGGGATTGGTCTAGTAGCTTTGTCAGTGAACCTGGAATATTGGAGCACCTAG
TGACCAAAGTATTGCTAGCTCCTGCTTGAAACTTGTATTATTAATGGGTGAACGTGTAAGGCGCTGTTTCAGACTTTAGCCCTGCGTGGCATGGTATTGT
AATGTTATCTGAACCTTCTAGCTATTATTCTGCTGCTATCTCTGATGTGTATCATTATTCGCTAGAGTGCGGCTATGGCGAATAATAATCC