Detailed information on CNT30576601


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553943Oryza barthiiOryza glaberrima77.1599.58100949forward
CNT30102028Oryza barthiiOryza rufipogon83.510099.421027forward

Expression of CNT30576601

Peptides detected in this lncRNA

>peptide 1 (46 aa)
LKSNVLPATTKTTTTAAAAAAIYYSLSIAYRRGKCEVEIESLRNRW*

>peptide 2 (31 aa)
MRLYITKVLSNPSNEQHTHLLISNTQIRCST*

>peptide 3 (35 aa)
MPECWPPSKEELEESLELTGIDAASQILPKVSFRV*

Sequence

>CNT30576601
GGCTCAAATCAAATGTACTCCCAGCCACTACCAAAACCACCACCACTGCTGCTGCTGCTGCTGCAATATATTATAGCCTCTCTATAGCTTATCGAAGAGG
CAAATGCGAGGTGGAGATCGAGAGCTTGAGAAATCGATGGTGAGAGTCACTCGTGTGTGATGGGGACATGCATATTCATATCATCCATCATCAATTTCAT
CATGCTGCTCCTACTACCCTACTTCATATTCTTTAATTGATACTATATTACTAGTATGTGGTTAATTACTCATATATTAGTAGTATAGCTTAAAGCTGCC
CGTGATCTCCAGCTAGCCGATCGATCAGCAGACTGCCACGAGCCTATGTAATTTATGGCAATCTAGGAGTAGACGTCAGTACACTTTGGATCACCTACTA
TTACATGACAATGCAAGCTCGGTGACCCGTGAGTGCTGCCAACACTGGCCCACTGCAGCTAGCTAGCAAACGAAGAAAATGTTCAGACACAACAAACAAG
CGACCACATTACGTGTACAGCCTCCGAAGCTTAATTAGCACACGGGCTGAACAGCTCCAAATGCCTGAGTGTTGGCCACCATCCAAAGAAGAATTAGAGG
AATCTTTGGAATTGACAGGGATCGATGCTGCATCACAGATTTTGCCAAAAGTCTCTTTCAGAGTATAGTGTCAATGCAAGTGTGCTGCTAGTTTCCTCCT
AAGCTAGTAGTGTCACCGGCCACTAGATGGAATAATATCCTTGTGTGCTTGGAGGGCAAAAGAGTTTCAGATTCAGAGACCCTTCTTTTCAGCACAACAA
CAGTGGAGAGGACAAAGATGAAACTGAAACGATGTGCCTGCCACGAAGTTGTTGATTAAGTCCGCATCATTAAGACTACTTGAGGTCATCAGGTGAATAG
TTAATTGGATTTGTAATTGGATATTGGTTGGGCGATTGAGGCTTAATTATGGTCCTGGATGATCTGGTCCGAATAACATAGTGTCAAACCCAAGATGCCG
AATCAATGATCGATATGTGTTAACGCATAGCTGTGGACAGATATCATATGGATATGGGATTGTTCTGGAATCAATATGAGATTATATATAACGAAAGTAT
TATCTAACCCATCGAATGAACAACATACTCATTTGCTGATTTCTAATACCCAAATTAGATGCTCTACATGATACAGCGTTGACGAGTCTCTGTCAGAATT
TGGATTGATAGGGAAGTACGGTGGTTGCAG