Detailed information on CNT30576582


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553766Oryza barthiiOryza glaberrima10071.2199.911123forward
CNT30370330Oryza barthiiOryza glumipatula98.3192.3899.821104forward
CNT30101746Oryza barthiiOryza rufipogon56.4659.4797.95634forward
CNT30116660Oryza barthiiOryza nivara98.2282.7599.461103forward
CNT30604109Oryza barthiiOryza punctata57.8859.1495.08650forward

Expression of CNT30576582

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MNDLRSFTFFTVSCATGNFVAVNSMMVADGEMR*

>peptide 2 (29 aa)
MRPPLRTPRCSTPCPCQHWQRKIKEQISW*

>peptide 3 (35 aa)
MVPFPFNSFFIFQDGEETAQPANQHPPKATNTALG*

>peptide 4 (81 aa)
MKVAARRRRLLGKGLPWCHSLLIHFSSSKMVRRQLSQPISTHPRPLTLPWDEISGMTSCCCSDVKYWVLTNRSGFSFFLSV*

>peptide 5 (71 aa)
MVTERRRGGVQMSISTKAMIAATRSPMRLNAASSSDSSVQHTLPMSALAEKDQRTNLLVIGGMLKQDESGS*

>peptide 6 (31 aa)
SIYIFPKLSIQAKDEETIIPINMTYNRMHYN*

Sequence

>CNT30576582
CAAGCATCTATATATTTCCAAAGCTATCAATTCAGGCTAAAGATGAAGAGACTATTATACCAATAAACATGACTTACAATAGGATGCATTACAATTAAGC
AATTATTTAACTTGAAAAATCAGGAGCCAATGCCTTGCCTTCCTGCTTTCTCCAACAACCTTCACCCTGCACATCTTTGATTCTTCAGAGAAGCAATCAA
GCTTCTCCCATCAGAGGACTCACAGTCCTGCAGGTACTCCTCCACCTCAGCAGCAAGGGTAGATGGTGACTGAGCGCCGCCGTGGCGGTGTGCAGATGAG
CATCAGCACCAAGGCGATGATCGCAGCGACGAGAAGCCCCATGAGGTTGAATGCGGCCTCCTCTTCGGACTCCTCGGTGCAGCACACCTTGCCCATGTCA
GCACTGGCAGAGAAAGATCAAAGAACAAATCTCTTGGTGATTGGTGGTATGTTGAAGCAAGATGAAAGTGGCAGCTAGAAGAAGAAGGCTTCTTGGCAAA
GGTCTCCCATGGTGCCATTCCCTTTTAATTCATTTTTCATCTTCCAAGATGGTGAGGAGACAGCTCAGCCAGCCAATCAGCACCCACCCAAGGCCACTAA
CACTGCCCTGGGATGAAATTTCTGGGATGACCAGTTGCTGCTGCTCAGATGTAAAGTATTGGGTTTTGACCAACAGATCTGGTTTTTCATTCTTTCTTTC
AGTATGAATGATCTGAGATCCTTCACCTTCTTCACTGTCAGTTGTGCTACTGGCAATTTTGTCGCAGTCAATTCGATGATGGTTGCTGATGGTGAGATGA
GATGAAAACTACACTGGATGCACTGATGATACTCCTGGTGAACTTGCAAAAGTTCAGAGATCTTACTTTCTGAAGGCTGTTGAAAAGTAATTCACTTCTT
CAGTGATTGAAGTCCTGGAAACAAAACAAGGTTGATTAGCATTTGCTGATGGCTACATTTCGTTCCCTGTGAAACACATCTCATTCAGGTTCAGCATTTG
AGTTTAGGTAGTAGCATACATTGGGTGACACATGTTGTGTGTCGGTGTGACTTAGACCTGCAATGAGTTGCCTTTTAATAATCTGGCACATGTTTTTCGG
GAAGGTGAAGCATGGCAACATGC