Detailed information on CNT30576567


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693833Oryza barthiiOryza sativa98.5910099.68630forward
CNT30553643Oryza barthiiOryza glaberrima99.0697.9999.84633forward
CNT3067518Oryza barthiiLeersia perrieri28.4834.2786.26182forward
CNT30596240Oryza barthiiOryza meridionalis78.494.5397.21501forward
CNT30370327Oryza barthiiOryza glumipatula98.998.7599.68632forward
CNT30108575Oryza barthiiOryza longistaminata87.1793.9397.67557forward
CNT30101831Oryza barthiiOryza rufipogon99.3798.9199.37635forward
CNT30116760Oryza barthiiOryza nivara99.3799.8499.69635forward
CNT30604159Oryza barthiiOryza punctata35.0542.2688.39224forward

Expression of CNT30576567

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MDASPHYAAAGCVTFAAIRGRETDEIKRCLDIICG*

>peptide 2 (55 aa)
MDSNNKNLQPPPGYPTVDSENGGRGRTTARGRKTRFIDGCIAALCCCWLCDLCCD*

Sequence

>CNT30576567
TTCAAACAACACAAATTTGACAAAGAAATTAACGCAGCTAGCTACTTGATCAAAGAAACCTCTCCTTGATCTAGTAGTGCGAGCTAGCTAGCTATAAATT
CGCAGTAGAACGCAGCCAGTGTGTAGCTAGCATGGACAGCAACAACAAGAACCTGCAACCACCACCAGGCTACCCGACGGTGGATTCAGAGAACGGCGGC
CGCGGACGAACGACGGCTCGCGGGAGAAAGACCAGATTCATCGATGGATGCATCGCCGCACTATGCTGCTGCTGGCTGTGTGACCTTTGCTGCGATTAGA
GGAAGGGAAACAGATGAGATTAAAAGATGCCTTGATATTATATGTGGATAGTATTTCTACATGGGTGTGCTGAAAAGAGGATCTTTGGAGCAGAGAATTG
AATACAACGAAATGTTGTTGCAGAAAGTATACATCCCGTAATTTCTGCGTATATTTTCGATATATATATAGCGCGGAATAATGAATAATGATATGCGTGA
AGTATCTATGTAATTCATTAATTACATAGTGTGCTCGTTTTGATTTGTATCCATTTTTCAGCTCATTTATTTTGACCCATATAAAAATGTATAGATAATC
TGATTCCTCAATTAATGAGTTAATCTTTCCTTGGCTCCA