Detailed information on CNT30576485


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 2e-158

BLAST vs NONCODE:
NONMEST001181, E-value = 6e-103

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693865Oryza barthiiOryza sativa99.3673.296.87926forward
CNT30553671Oryza barthiiOryza glaberrima99.3679.6297.19926forward
CNT30254194Oryza barthiiAvena sativa74.3673.7289.9693forward
CNT30596296Oryza barthiiOryza meridionalis93.8863.5491.77875forward
CNT30370375Oryza barthiiOryza glumipatula99.8997.5999.68931forward
CNT30110940Oryza barthiiOryza longistaminata82.328.2892.31767forward
CNT30116852Oryza barthiiOryza nivara99.2577.8697.08925forward

Expression of CNT30576485

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MVSELSTSRVMVLPVRVLTKICIPPLRRSTKCRVDSF*

>peptide 2 (44 aa)
MRRCWSGGIPSLSWILAFTLSMVSEDSTSRVMVLPVRVFTKICIC

>peptide 3 (47 aa)
MTQQMFGQQYSTFKRTRWSTNSTNKVFTRIMQTQDNSTAAIPSINDY*

>peptide 4 (61 aa)
MSLCWSGGMPSLSWIFAFTLSMVSELSTSRVIVLPVRVLTKICIPPLRRRTRWRVDSFWML*

Sequence

>CNT30576485
TGTAGGCAAATTTGAATGAAGAGTTGTAATGGGTGCAGAACTATAAGCAAATTTAGCAACGCAGATTAATAGTTTACTTATTAATTAGTTTAAACTGCTA
TGACCCAGCAAATGTTCGGACAGCAGTACAGCACATTTAAACGGACTCGATGGTCCACTAACAGCACAAATAAAGTTTTCACGAGGATAATGCAGACACA
GGATAACAGTACAGCAGCAATTCCATCAATCAATGATTACTGACCACCCCTGAGGCGGAGCACCAGGTGGAGGGTAGACTCCTTCTGAATGTTGTAGTCG
GCGAGGGTACGGCCATCTTCCAGCTGCTTGCCGGCGAAGATCAGGCGCTGCTGGTCTGGGGGAATACCTTCCTTGTCCTGGATCTTAGCCTTCACATTGT
CGATGGTATCGGAGCTCTCAACCTCCAGAGTAATGGTCTTGCCAGTGAGAGTCTTGACGAAGATCTGCATACCACCCCTGAGGCGGAGCACCAAGTGTAG
GGTAGACTCCTTCTGAATGTTGTAGTCAGCAAGGGTGCGGCCATCCTCCAGCTGCTTACCAGCGAAGATGAGTCTCTGCTGGTCCGGGGGGATGCCCTCC
TTATCCTGGATCTTCGCCTTCACGTTGTCGATGGTGTCTGAGCTCTCAACCTCCAGGGTAATAGTCTTGCCAGTGAGAGTCTTGACGAAAATCTGCATTC
CACCCCTTAGGCGCAGAACAAGGTGGAGGGTGGATTCCTTCTGGATGTTGTAGTCAGCAAGCGTGCGCCCATCTTCGAGCTGCTTGCCAGCGAAGATGAG
ACGCTGCTGGTCCGGTGGGATTCCCTCCTTGTCCTGGATCTTGGCCTTTACATTGTCAATGGTATCCGAGGACTCAACCTCAAGGGTTATGGTCTTGCCA
GTGAGAGTCTTCACAAAGATCTGCATCTGCAA