Detailed information on CNT30576441


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553831Oryza barthiiOryza glaberrima98.95100100284forward
CNT30107572Oryza barthiiOryza longistaminata75.2615.6795.37216reverse complement
CNT30604175Oryza barthiiOryza punctata54.764.3487.9157forward

Expression of CNT30576441

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MILHGPSDIQCEKTEKQNAQVPHRLLRKTAGSNSYSG*

Sequence

>CNT30576441
AGCAGGATCCATGCTGAATGATCTTGCATGGACCAAGCGACATTCAATGTGAAAAAACAGAAAAACAAAATGCTCAAGTTCCGCACAGATTGCTAAGAAA
AACAGCTGGATCCAATTCATACTCAGGCTGAGAGAGTGCAAGCACAAAGTACAACTGAGCGTCTTCAGCTGACTTTGTTTATTATTACAATTACACTGCA
TGGTGGTTCAATATGTTTCAAATAGGTGAACAAAGATTTAAGCAGACTATATAACACATATATGGATATTTTTGACAATAGGATCAG