Detailed information on CNT30576413


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673552Oryza barthiiSetaria viridis18.4456.1992.37118forward
CNT30435520Oryza barthiiAegilops tauschii18.7529.6387.5120forward
CNT30241644Oryza barthiiAvena sativa18.4420.187.29118forward
CNT3011240Oryza barthiiZea mays11.4130.2987.6773forward
CNT30149367Oryza barthiiBrachypodium distachyon19.2231.2291.06123forward
CNT30116828Oryza barthiiOryza nivara57.9761.7398.92371forward

Expression of CNT30576413

Peptides detected in this lncRNA

>peptide 1 (29 aa)
FIHMIMMSTYLEKTLLHTCMARYINKTIN*

>peptide 2 (73 aa)
MSWALSRPVKLYSLSVKEKQCDHVGAGDGARACLLHGGLHPLDEAEPAQRLVRRRVLLRRAVPGRVEQHRAVAT

>peptide 3 (41 aa)
MPSPRRPSPSRRSRTRAASGSASRPSPPCCSRPSRAAPSRRN

Sequence

>CNT30576413
GTTTATTCATATGATCATGATGAGCACGTACTTGGAGAAAACTTTGTTACATACATGCATGGCTCGCTATATAAACAAAACAATTAATTAATGAAGTGAT
TGAAATCAAGAAAAAAAAAGAAGGGACAGGTAAATCTTACGATAATGATCTACATGGAAATTAATTATAAGATGGTCACGGCCGGAATCAAAAGCTGAAA
TCCATAATCACACTCGGTCTCGGCGAGCAGCTGATGATATATGACGATAATTAAGAGAGATGATTAGTTAACCACGTTGCACTTCTTCCTGATCTCGCCC
TGGCTGCCGGTGAGCACTTCGACGCCGCCCATCTTGACCATGGAGGCGGCGAAGTCGGCGAAGAACTCGTCCTTGTAGCCGCCGCCGGCGTGGCGCTGCA
CCTCCAGCGTCGGGTCGATGTCGTGGGCGTTGTCCAGGCCGGTGAAGTTGTACAGCCTGTCAGTGAAGGAGAAGCAGTGCGACCACGTCGGCGCAGGAGA
CGGTGCCCGGGCATGCCTTCTCCACGGCGGCCTTCACCCTCTCGACGAAGCCGAACCCGCGCAGCGTCTGGTTCGGCGTCGCGTCCTTCTCCGCCGTGCT
GTTCCCGGCCGAGTCGAGCAGCACCGAGCCGTCGCAACCC