Detailed information on CNT30576411


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673381Oryza barthiiSetaria viridis35.8459.4285.48186forward
CNT30381543Oryza barthiiManihot esculenta32.1817.1884.43167forward
CNT30553708Oryza barthiiOryza glaberrima55.378.2100287forward
CNT30172707Oryza barthiiTrifolium pratense23.5123.1585.25122forward
CNT30144281Oryza barthiiMedicago truncatula27.5536.7685.31143forward
CNT3010905Oryza barthiiZea mays13.8724.1693.0672forward
CNT30359398Oryza barthiiLactuca sativa20.6220.1184.11107forward
CNT30370323Oryza barthiiOryza glumipatula49.5257.2499.61257forward
CNT30149118Oryza barthiiBrachypodium distachyon40.6665.5387.68211forward
CNT30604156Oryza barthiiOryza punctata49.94696.53259forward
CNT30556997Oryza barthiiPanicum hallii27.3640.5791.55142forward

Expression of CNT30576411

Peptides detected in this lncRNA

>peptide 1 (34 aa)
GKQRKVLIIMFPEVRYIQQTQNAGKLFKRFPASL*

>peptide 2 (66 aa)
MTPGSSFPSNSSKLAPPPVEMWLITSATPTFSTAATESPPPIMVVTPLPLRSIPNDCLCCFQGRAE*

>peptide 3 (34 aa)
MTVCVVSRVELNDATESGPISRPIQPSGIADAGTT

Sequence

>CNT30576411
GGGGGAAACAACGTAAGGTATTGATAATTATGTTTCCTGAGGTAAGGTATATCCAACAAACACAAAATGCTGGGAAGTTATTCAAACGATTTCCAGCATC
TCTATAAAACATTGGTCTCTTACATTTCGAGTGGTTGAAGAGGTGCGAGAAAGGAGTAGAATATAGCAAGTTTAGAATGGTACATGAAGAAGATGCAACA
AAATGAAACTTAGCCTCATACGGCCACAGTGACAGCTTCATCAAGTGCAATGACTCCAGGAAGTTCCTTTCCTTCCAACAGCTCCAAGCTAGCACCACCT
CCCGTTGAAATGTGGCTCATAACATCCGCAACTCCCACCTTCTCAACAGCGGCAACAGAATCACCTCCTCCAATAATGGTTGTAACACCCTTGCCGCTAA
GGTCCATTCCAAATGACTGTCTGTGTTGTTTCCAGGGTAGAGCTGAATGACGCGACTGAATCTGGACCAATATCCAGACCCATCCAACCATCAGGAATAG
CAGATGCTGGAACAACCTG