Detailed information on CNT30576409


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693682Oryza barthiiOryza sativa66.4890.799.49585forward
CNT30101813Oryza barthiiOryza rufipogon28.5253.75100251reverse complement

Expression of CNT30576409

Peptides detected in this lncRNA

>peptide 1 (74 aa)
VEEKTGFPHLHGSTFAHFLSPYSLPLPSPQSLLHEPPPPPPQPLISPYVVPPPSRWCLGMLPINNSLSSSAYCC*

>peptide 2 (33 aa)
MFDCDVNLWLLCFLKNVYLFKASARIELSLYFF*

>peptide 3 (37 aa)
MSLSRMDLGMVSGIEALPSELWQRAEFSTMMAARCCD*

>peptide 4 (63 aa)
GGKNRLPSPPRLYVRSLPLPLLSPSPISPIPAPRATTASATTPHLPLRRASSLSMVPWHAPNQ*

>peptide 5 (66 aa)
WRKKPASLTSTALRSLTSSPPTLSLSHLPNPCSTSHHRLRHNPSSPPTSCLLPLDGALACSQSIIP*

>peptide 6 (28 aa)
MFLIRHRHAYYIVSRLSKSDIYMRFTTRT

>peptide 7 (29 aa)
MDPEVAATGGSSASGVWCSHEQIRQQQGL*

Sequence

>CNT30576409
GTGGAGGAAAAAACCGGCTTCCCTCACCTCCACGGCTCTACGTTCGCTCACTTCCTCTCCCCCTACTCTCTCCCTCTCCCATCTCCCCAATCCCTGCTCC
ACGAGCCACCACCGCCTCCGCCACAACCCCTCATCTCCCCCTACGTCGTGCCTCCTCCCTCTCGATGGTGCCTTGGCATGCTCCCAATCAATAATTCCTT
GAGCTCGTCGGCATACTGCTGTTAACGACCAGCATCAACAACTGCATGGATCCGGAGGTGGCAGCAACAGGCGGATCGAGCGCTAGTGGTGTTTGGTGCT
CTCACGAGCAAATCCGGCAACAGCAAGGGCTCTAGCAGGCGGATCCAGCGGTGGGTGCTCTTGCGAGCACATCCGGCAGTAGCAAGGGCTCTAGCAGGCG
GATCCAGCGGCGGCAAGGGCTCTCGCGGCGGTGGGTGCTCTTGCGGGCAGATCCAGCAGTGACAATGACTTGTGGGCGGATCCAGCGATGTCGCTCTCTC
GCATGGACCTAGGGATGGTAAGCGGCATCGAAGCCCTCCCCAGCGAGCTATGGCAACGGGCGGAGTTCTCCACTATGATGGCGGCTAGGTGTTGCGATTA
GTGTATTGTGTGATTGATTCTATGATGATGTGCTTGTGTACTTCGGTTCTCGGATGTTGAGCGATGAATGTTCGATTGTGACGTGAACTTGTGGCTTCTT
TGTTTTTTAAAAAATGTTTATTTATTTAAAGCATCAGCTCGAATTGAGCTAAGCCTGTATTTTTTTTAATTGAGTCGTACAACTCATATAGGTATGTTCT
TAATCCGACACCGACATGCTTACTATATCGTCTCTCGGTTAAGTAAATCCGATATCTATATGAGATTCACAACCAGAACT