Detailed information on CNT30576365


BLAST search results

BLAST vs Swiss-Prot:
sp|A5H8G4|PER1_MAIZE, E-value = 7e-25

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30576365

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MTLQLSLISPCVPDSTSICPILIMALANLSRNVASLRTKEFTVALSVASVRSAASDWKSPRLFVSPT*

>peptide 2 (45 aa)
LMCKVNNMNRPQEQHLTPMHAGCNFIFQTHKHKMVTVSTTNTYIS*

>peptide 3 (38 aa)
MSMKVVVVGNVWLLFGGQMPFSKNAYALLNDGSICSHV*

Sequence

>CNT30576365
CTTATGTGCAAGGTTAACAATATGAACAGGCCCCAAGAACAACATCTGACACCAATGCATGCTGGATGCAACTTTATTTTTCAGACTCACAAGCACAAGA
TGGTGACAGTATCAACCACCAACACCTACATCAGTTAATTAATTAGCTTGCAGCCACTTCATCTGAAGAAGAAGAGGAAGAGGAAGTAAGGTGGTGATCA
TCAGCTGCAGTAGCAGTGACATTGACAGGGTTGATGACCCTGCAGTTGAGCCTGATCTCGCCCTGCGTCCCGGACAGCACGTCGATCTGCCCCATCTTGA
TCATGGCCCTGGCGAACTTGAGCCGGAACGTCGCCTCGCTGCGCACGAAGGAGTTCACCGTGGCCTTGAGCGTCGCATCTGTCAGAAGCGCCGCATCTGA
CTGGAAGAGTCCGAGGTTGTTTGTCAGCCCGACGTAGTACCTGTTGTCGAACTTGGTCGGCGTCAGGATGTCCATGAAGGTCGTCGTCGTCGGGAACGTC
TGGTTGCTGTTCGGCGGACAGATGCCCTTCAGCAAGAACGCGTACGCCTTGCTCAACGACGGATCAATCTGCAGTCACGTATAATACGAGATAATCACAC
AGGTTAGACGAACTGATGAT