Detailed information on CNT30576360


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693848Oryza barthiiOryza sativa10057.96100484forward
CNT30101654Oryza barthiiOryza rufipogon10075.86100484forward
CNT30116839Oryza barthiiOryza nivara10075.9899.59484forward

Expression of CNT30576360

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MSISIEKGRQRGKRSELKRYSVPHFLLLPFP*

Sequence

>CNT30576360
AAAAACCTGTGTGTGTGCACTTCTTTGTGTTTATCTCCATTGAGCCATAGAGAGAAAAGCTGAGTGCGCGTGCGTCGCCATTGTCGTGTCCACTACAATT
TGCCACTTGTGCGTGTGTGCCATCGCTTGAGTTCGCTGCTCGCCGCGGAGCCTAAGTCAGGACTAGTCATACTGACATGCCAAGAGAAGACTGAAGCGAA
TCATGCATGAAGCGAAGCAATCGCTGATCCTGACATTGTCCCTGCCGGCAGAACATGTTCTCTGATACCTCCTATGTCTATTTCAATCGAGAAAGGAAGG
CAGAGAGGTAAAAGAAGTGAATTAAAAAGGTACTCTGTTCCTCACTTTCTCCTTCTGCCATTCCCATAAGAATCACCAAATAACATGGAATTCAGGCAGT
GTTGGTTACTCTCTGTCAATGACCATATATATGGTCCATATGTATAAATACTCGGCAATCAACATGAACTGGACAAGGACTGAG