Detailed information on CNT30576330


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30370371Oryza barthiiOryza glumipatula21.930.9794.53201forward
CNT30116857Oryza barthiiOryza nivara41.3952.9298.68380forward

Expression of CNT30576330

Peptides detected in this lncRNA

>peptide 1 (61 aa)
MRTDPPEKNPANKKMTRRQEQGREHVSGQGSRIPSEQCAALTLALHCRALYFGQRKHPAHET

>peptide 2 (47 aa)
MMMMMMMGQKYHPRMRTYRMFLHSAIVVALVQESGVHHGAKIWESSG*

>peptide 3 (46 aa)
RNPLIPSLPQQKASSLSMLLIYYYYNKIKIPHLDLDELRQIPPLYG*

>peptide 4 (35 aa)
MNSARFRRFTGELEHRLPEQSIVSSSPPLIKRLCR*

Sequence

>CNT30576330
GCGTAATCCCTTGATCCCTTCCCTCCCCCAACAGAAGGCATCGTCTCTCTCCATGCTGCTGATCTACTATTACTACAACAAAATAAAAATTCCCCACCTT
GACCTAGATGAACTCCGCCAGATTCCGCCGCTTTACGGGTGAGCTCGAGCACCGCTTGCCCGAGCAGTCGATTGTCTCGAGCTCGCCACCACTGATCAAG
CGCCTTTGCCGCTGAGTTGGAGCTGATGCATGGTTCAGCTCGTGCAAATTAATCAATGTCCAGCTGCATCAAAGTGCATGAGCTTGGATCTAGAAGATCC
ATGATGTGATCGATGCTAACATCGTCAAGTATTACGCCAACCTGTGGATCCAATCCAGCCCCTGTGACTTGATTTTGTTCACAGGATTTGATGATGATGA
TGATGATGATGGGGCAGAAGTATCATCCAAGAATGCGAACGTACCGCATGTTCCTGCATTCTGCAATTGTGGTGGCATTGGTTCAGGAATCGGGAGTTCA
TCATGGTGCCAAGATTTGGGAGAGTTCTGGTTAGTGTGGAGACGCAATCTGTGTAGATGAAAATAAAACAACTGTGTATTTGTACTTATGTACCGCTCTA
ATCCTTTTTCCCGCCACTAATTTTATTTGCTTGGCGCCATATTTTTGTTAGCGTTTAAATTGCGTTGTTTCCAATTTAATTGTGATATTACAACATGGGA
CGATGACGCCGTTTAAGTGAAAGAGGAGCGCATGCGTACTGACCCACCAGAAAAAAACCCAGCGAATAAGAAGATGACACGTCGCCAGGAACAGGGAAGG
GAACATGTATCGGGACAGGGAAGCCGCATCCCCAGCGAGCAGTGCGCCGCGTTGACTCTTGCTTTGCATTGCAGGGCCCTCTACTTTGGGCAGAGGAAAC
ACCCGGCTCACGAAACAC