Detailed information on CNT30576297


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30100988Oryza barthiiOryza rufipogon10.8921.5889.43123reverse complement
CNT30604135Oryza barthiiOryza punctata70.6894.4489.97798forward
CNT30551113Oryza barthiiOryza brachyantha28.0831.4588.01317forward

Expression of CNT30576297

Peptides detected in this lncRNA

>peptide 1 (58 aa)
MLGSPIYQSPILLTQKFLRLLLSSSIDIRKRQIHQDVHLTIWPCFRLKLIGPINLMRL*

>peptide 2 (87 aa)
MEKVGSLKKKFGTKQGQSTEEIPRICILFFRDSAHRLKGLTNLQAKAAPSSETTPFPFLYVWSKKYQTVFLSYNLYSCAPYFLAGAT*

>peptide 3 (38 aa)
MQMLSYCSYTDFKLPILPHLNYHAVDYYEVWTPRQLQFC

>peptide 4 (41 aa)
MKFQDVILNKIGTSNFCSITSNRSYQLPSDFFFFATISSVE*

>peptide 5 (31 aa)
MSGARSIKLFSFHIIFTPAHLIFWLVRHEIY*

>peptide 6 (34 aa)
MIAILRLARLSHLTECFISSLAHLCFLLTGTNYT*

Sequence

>CNT30576297
AATATTTGTGCTATTACATAAAAATATAAATGATTGCTATTTTGAGGCTTGCAAGGCTATCACATCTAACGGAATGCTTTATTTCTAGCTTAGCTCATTT
ATGTTTCCTTCTGACAGGTACTAATTACACTTGAATGAAATGAGTGCTACAGAGGGTGTGTTTAGTTCACGCTAAAATTGAAAGTTTGGTTGAAATTGGA
ACAATTTGACGGAAAAGTTGGACGTTTGTGTGTGTAGGAAAGTTTTGATGTGATGGAAAAGGTTGGAAGTTTGAAGAAAAAGTTTGGAACTAAACAAGGG
CAGAGTACAGAAGAAATTCCAAGGATATGTATTCTTTTTTTTCGTGATTCTGCCCATCGTCTGAAGGGTCTGACGAATCTACAAGCTAAAGCAGCGCCAT
CCAGTGAAACAACACCGTTTCCTTTTCTGTATGTCTGGAGCAAGAAGTATCAAACTGTTTTCCTTTCATATAATCTTTACTCCTGCGCACCTTATTTTTT
GGCTGGTGCGACATGAAATATACTGATACTAACTTGATACTAACTTGAAGCCATTAGTTGTCCATAACTCCATATAGAACCTGAGCTAGAGGCTAAAGCC
TAGAGGTTTAGTGACTTCTGTACGAGGTACCATACGGTATATCCTGGATTCATTCCATGTTCAGCTGTAGGATATCCTTCAGAAATTAGTTCGACCAATA
ATGCTGGGATCTCCCATTTATCAGTCACCAATCCTGCTAACCCAGAAATTCCTTCGGCTGCTACTTTCATCATCCATCGACATTAGAAAAAGGCAGATCC
ATCAGGACGTGCATTTGACAATTTGGCCCTGCTTCAGGCTGAAATTGATTGGTCCCATCAACTTGATGAGGTTATGAAATTTCAAGATGTGATCCTGAAC
AAGATTGGGACATCAAACTTCTGTAGCATTACATCCAACAGGAGCTATCAACTACCAAGTGACTTTTTTTTTTTTGCCACCATCAGTTCAGTGGAGTAGA
GGAGTCCGCCTCATGCAGATGTTATCTTACTGTAGTTATACTGATTTTAAGTTGCCCATTTTGCCACATCTTAACTACCATGCTGTAGACTACTATGAAG
TCTGGACACCCCGGCAACTTCAATTTTGC