Detailed information on CNT30576291


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30370372Oryza barthiiOryza glumipatula102.2254.9997.02369forward
CNT30101794Oryza barthiiOryza rufipogon60.9436.67100220forward
CNT30116825Oryza barthiiOryza nivara67.0442.53100242forward

Expression of CNT30576291

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MQPGDDDDRFSCRSSRSSRCSWCHTCRCCSRSRR

Sequence

>CNT30576291
GATGAAAGCAGAGGTAGATTATATTAAGAAGCCTGGCACGCATGAGGAGATGGAGCAGGAGTACATGATGAGATCACCATGATGATAGATGATCCATCCA
AGCTAGCTAGGGATCCATCCAACGACGACGACGGTTTTATTTAGGCGTCAGAGCAAAAGGCAAGGCCTGCCTACATATAAGCTGGGTACTAATGCAAGCA
AATTAAGGCCTCGATCAAAGCTCTGATCGACAGTAGCAGCATCCATACGATAAATCCTCATGCAGCCGGGCGACGACGACGATAGATTCAGTTGCAGGAG
CAGCAGGAGCAGCCGCTGCAGCTGGTGCCACACTTGCAGGTGTTGCAGCCGCAGCCGCCGT