Detailed information on CNT30576202


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006600, E-value = 3e-62

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30550451Oryza barthiiOryza brachyantha20.715.1595.7170reverse complement

Expression of CNT30576202

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MDSPATPTDFSPLHSLAHYNESCYTKDKAFA

>peptide 2 (72 aa)
RLITKNIAQLTHNRGHGYSNSFTLIRGVPLYPQDTIPQHVTMRLSTTTVPWKGTVTIPLAQHNTPQCTVPGS*

Sequence

>CNT30576202
TGAGACTAATCACAAAAAATATTGCTCAACTCACCCATAACCGCGGGCACGGCTATTCGAATAGTTTTACTCTGATCAGAGGTGTACCACTGTACCCACA
AGACACAATCCCACAACATGTCACCATGCGCCTCAGTACCACCACGGTACCTTGGAAAGGAACTGTGACAATACCCCTCGCACAACACAACACACCACAG
TGCACCGTTCCTGGATCATAATCTCCCCCTCAAAACCAGAGGCAATGGACTCCCCAGCGACCCCCACGGACTTCTCGCCGCTTCACAGTCTGGCGCACTA
TAATGAATCATGCTATACAAAAGATAAAGCCTTTGCCC