Detailed information on CNT30576090


BLAST search results

BLAST vs Swiss-Prot:
sp|O64477|Y2913_ARATH, E-value = 1e-74

BLAST vs NONCODE:
NONORUT004101, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30226540Oryza barthiiHordeum vulgare64.7423.1978.22404forward

Expression of CNT30576090

Peptides detected in this lncRNA

>peptide 1 (46 aa)
NVVRTLLKSLPTNTAIPKSAILGVNDSSRSMFCGLISQCMMHSWQL*

>peptide 2 (36 aa)
MQVGKPSSNSYGYLIPGAPLQYSSIALKQMGIKGTI*

Sequence

>CNT30576090
AAATGTAGTCAGAACTCTGCTAAAATCCCTTCCTACAAATACTGCCATCCCAAAATCTGCAATTTTAGGAGTAAATGATTCGTCGAGAAGTATGTTTTGC
GGCTTAATATCACAGTGTATGATGCATTCGTGGCAGCTCTGATGCAAGTAGGAAAGCCCTCTAGCAACTCCTATGGCTATTTGATACCTGGTGCTCCACT
TCAGTATAGTAGCATTGCTCTGAAACAGATGGGTATCAAGGGAACCATTTAACATGTGTTCATAAACAAGTAGCCTCTTGTCACCTTGGCAGCAGAAACC
AATCAACTTGACTAGGTTGATATGTTGGATCAATCCAATTGAGCTCACCTCAGCACGGAATTGCTTCTCTCCCTGACGATCACCATCAAGTCTTTTCACA
GCTATGGTAGTTAGATCAATTAACATTCCCTTGAACACAGAGCCAAAACCACCTGCTCCAAGCTTTTCTGAGAAATTTTTAGTGGCATGAACTAGATCAT
TGTATCTAAATGCCTTAATTCCACTGCTGTCTTCACCGTCATGTAATGGCGCACCACACCACTCGAATCTGTTCCTCCACATCAGTAAAAACATCCCGAC
CATTAATAACACAAAACCAATTAC