Detailed information on CNT30576067


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004177, E-value = 2e-110

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30101268Oryza barthiiOryza rufipogon89.8653.3698.69381forward

Expression of CNT30576067

Peptides detected in this lncRNA

>peptide 1 (73 aa)
HSHRNASHADDALEHAPERRRFGIIVVWPSSFISSQAVVPQILPRLPPQDASRITTRDTRNTENTSFSSSSPI*

>peptide 2 (43 aa)
QPPERKPRRRRPGARTGAPPLRHHRRLAILVHLEPSRCAANIA*

>peptide 3 (88 aa)
TATGTQATPTTPWSTHRSAAASASSSSGHPRSSRAKPLCRKYCLGFLLRTPQESPPETLGTRRTHPFLPRRRSEPVAIAIVNSFHSGP*

Sequence

>CNT30576067
CACAGCCACCGGAACGCAAGCCACGCCGACGACGCCCTGGAGCACGCACCGGAGCGCCGCCGCTTCGGCATCATCGTCGTCTGGCCATCCTCGTTCATCT
CGAGCCAAGCCGTTGTGCCGCAAATATTGCCTAGGCTTCCTCCTCAGGACGCCTCAAGAATCACCACCAGAGACACTAGGAACACGGAGAACACATCCTT
TTCTTCCTCGTCGCCGATCTGAACCCGTCGCCATCGCCATTGTCAATTCCTTCCACTCCGGTCCTTGAGCCATTCGAGCCGACGTCGTTCAACCCCGGAG
AAACGCCGCCACTAGAATGATCCGCAAGCCGTCGCAGCCGCCAAGACCTTAACGACCTCGTCTGAGCCCTCGATGATTGCTTAAACGGTGAAGAAGTGAT
TTAGGTGCTGACTTTTTCCAGTTT