Detailed information on CNT30575967


BLAST search results

BLAST vs Swiss-Prot:
sp|P36494|CB4_SPIOL, E-value = 5e-109

BLAST vs NONCODE:
NONORUT004556, E-value = 2e-167

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676418Oryza barthiiSetaria viridis27.277490.54222forward
CNT30523695Oryza barthiiSetaria italica52.9550.8390.02431forward
CNT30517895Oryza barthiiJuglans regia43.7333.7478.09356forward
CNT30728490Oryza barthiiCorchorus capsularis15.8520.7485.27129forward
CNT30709868Oryza barthiiGlycine max15.3622.4480.8125forward
CNT30385668Oryza barthiiTriticum turgidum22.635.0592.93184forward
CNT30539684Oryza barthiiBrassica napus17.8133.9688.28145forward
CNT30553353Oryza barthiiOryza glaberrima82.0693.1798.5668forward
CNT30436497Oryza barthiiAegilops tauschii49.1463.987.5400forward
CNT30242488Oryza barthiiAvena sativa52.4654.1992.97427forward
CNT30657766Oryza barthiiTriticum dicoccoides52.9564.9187.94431forward
CNT3079565Oryza barthiiBrassica juncea39.4332.7685.98321forward
CNT30464459Oryza barthiiSaccharum spontaneum52.4648.7490.63427forward
CNT30133056Oryza barthiiLolium perenne35.0149.7491.58285forward
CNT30607010Oryza barthiiGossypium raimondii41.1540.9577.31335forward
CNT30680613Oryza barthiiTriticum urartu40.2964.4491.77328forward
CNT30346723Oryza barthiiEragrostis tef27.0340.5990220forward
CNT30366412Oryza barthiiSorghum bicolor21.2537.2892.49173forward
CNT30596187Oryza barthiiOryza meridionalis47.7988.6199.23389forward
CNT30360809Oryza barthiiLactuca sativa19.0427.7381.29155forward
CNT30370016Oryza barthiiOryza glumipatula46.5643.1299.21379forward
CNT30151656Oryza barthiiBrachypodium distachyon22.1137.7492.22180forward
CNT30585419Oryza barthiiEchinochloa crusgalli40.2933.8889.63328forward
CNT30498137Oryza barthiiDigitaria exilis48.8941.289.7398forward
CNT30116579Oryza barthiiOryza nivara52.9568.6399.54431forward
CNT30558336Oryza barthiiPanicum hallii38.8254.391.77316forward

Expression of CNT30575967

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MQQLAIKHEARMQAKPNSVCQIHGERERG*

>peptide 2 (74 aa)
MSSSCVPRREPKEKGAMASGCAPASNHGTPLHACPTKIPSTAAIAHRPWISSASLYHLRNAGSLPSPSGSKPKSP

Sequence

>CNT30575967
AATATCCTTGCTCATCCTGCAGCCTTAATTATATATATTACATATGGTACATACACTGGGAAGAAAAATAAAAAAAGAACTCCTTGATTAATTCCCCCAT
TTGGTTCACGCACACCACCCAACCCAAAAGCGGCCACGAACACAACAAGATACATTTTGCTACTGCTCCTCCGACCTCCAATCGTTCGATCCGAGCCCAT
GCACGCGCCCGATCGATGCAACAGCTAGCGATCAAACACGAAGCGCGCATGCAAGCGAAACCCAACTCTGTGTGTCAGATCCATGGCGAGCGAGAGCGGG
GTTGATTGCTCATAGGCCGAGGGCGCCGAGCGGCGTCTTGCCCTGGCCGGCCTCGAAGTAGAAGATGAGCATGGCGAGCATGGCGAGCTTGTCGGTGTCC
GGGATGTAGACGCCGTCCCTGGTCTCGCCGCCGAGGCCGAGCGGGTCGAAGAACTTGCCGCCGGGGTAGCCCTGCTCGCCGGTGGCGTTGGAGAAGTTCT
CGGCGGTGCGCGACCACGGCGTGGCCCACTCCACCGCCTGCGAGTCCGGGTTGAAGAAGTCGACCCACCGCTTGGACTCCACCCAGCCCATGAGCAGCAG
CTGCGTCCCGAGGAGGGAGCCGAAGGAGAAGGGCGCGATGGCCTCCGGCTGCGCGCCGGCCTCGAACCACGGCACGCCGCTCCACGCCTGCCCGACGAAG
ATCCCCAGCACCGCCGCCATCGCCCACCGCCCATGGATCAGCTCCGCCTCCCTGTACCACTTGAGGAACGCCGGGTCCTTGCCCAGCCCCAGCGGGTCGA
AGCCGAAGTCACCG