Detailed information on CNT30575945


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691733Oryza barthiiOryza sativa10029.1699.47377forward
CNT30553511Oryza barthiiOryza glaberrima80.3766.5996.04303forward
CNT30101033Oryza barthiiOryza rufipogon59.1510099.55223forward

Expression of CNT30575945

Peptides detected in this lncRNA

>peptide 1 (66 aa)
SLELPFSLSIHGRSSTPSVDLPIRSSTSPILAPPASPPSGESVFPLSPLPPPLSQATTAIIHAGSR*

>peptide 2 (63 aa)
MPARGEPLPPPFRLYISPSRPATDLPGCASLGNTRGRCLRGRSSTGASAPLLSLLSVCSAGREE

>peptide 3 (52 aa)
ASSSLSLSPSMADRRRRRSISPSVAPPPLSSRHQLRLHPASPFFPFPLSLHL*

Sequence

>CNT30575945
GAGCCTCGAGCTCCCTTTCTCTCTCTCCATCCATGGCCGATCGTCGACGCCGTCGGTCGATCTCCCCATCCGTAGCTCCACCTCCCCTATCCTCGCGCCA
CCAGCTTCGCCTCCATCCGGCGAGTCCGTTTTTCCCCTTTCCCCTCTCCCTCCACCTCTAAGTCAAGCCACCACCGCCATCATCCATGCCGGCTCGAGGT
GAGCCCTTGCCGCCGCCGTTCCGGCTATATATCTCTCCCTCTCGGCCAGCCACCGACCTCCCCGGGTGCGCGTCGCTCGGGAACACGCGTGGCCGCTGTC
TTCGAGGCCGTTCATCCACCGGAGCATCGGCGCCCCTCCTCTCCCTTCTCTCTGTTTGCTCGGCTGGAAGAGAAGAA